Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02829
Secondary Accession Numbers
  • 8336
Name Oxysterol-binding protein 1
Synonyms Not Available
Gene Name OSBP
Protein Type Enzyme
Biological Properties
General Function Involved in steroid metabolic process
Specific Function Binds cholesterol and a range of oxysterols. Cholesterol binding promotes the formation of a complex with PP2A and a tyrosine phosphatase which dephosphorylate ERK1/2, whereas 25- hydroxycholesterol causes its disassembly. Regulates cholesterol efflux by decreasing ABCA1 stability
Pathways Not Available
Reactions Not Available
GO Classification
Process
metabolic process
primary metabolic process
lipid metabolic process
steroid metabolic process
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q12-q13
SNPs OSBP
Gene Sequence
>2424 bp
ATGGCGGCGACGGAGCTGAGAGGAGTGGTGGGGCCAGGCCCGGCAGCCATTGCAGCACTT
GGCGGCGGCGGCGCCGGTCCCCCAGTGGTGGGAGGAGGCGGCGGCCGCGGAGATGCGGGG
CCAGGCTCCGGGGCCGCGTCAGGGACGGTGGTCGCGGCGGCGGCGGGAGGCCCGGGCCCG
GGGGCCGGGGGAGTGGCGGCGGCTGGCCCGGCCCCTGCGCCGCCGACTGGGGGCTCGGGC
GGCTCGGGCGCTGGGGGTTCGGGCTCGGCTCGAGAGGGCTGGCTCTTCAAATGGACCAAT
TATATCAAAGGCTACCAGCGGCGATGGTTCGTGCTGAGCAACGGGCTCCTGAGCTACTAC
AGATCAAAGGCAGAAATGAGACATACCTGCCGTGGTACCATCAACCTCGCCACAGCCAAC
ATCACCGTGGAGGACTCCTGCAACTTCATCATTTCCAATGGGGGTGCTCAGACCTACCAT
CTGAAAGCTAGTTCAGAAGTTGAGCGGCAGCGCTGGGTGACGGCCCTGGAACTGGCCAAG
GCCAAAGCTGTGAAGATGCTGGCAGAGTCAGATGAATCAGGAGATGAAGAGTCTGTCTCA
CAAACTGACAAGACTGAGCTGCAGAATACCCTTCGGACCCTCTCTAGCAAAGTAGAGGAC
TTGAGCACGTGCAATGACTTGATAGCTAAGCATGGCACAGCTCTGCAGCGTTCTCTCAGT
GAGCTGGAGTCCCTGAAGTTGCCTGCTGAGAGCAATGAAAAGATCAAACAGGTCAACGAA
CGAGCCACACTCTTTAGGATAACATCCAATGCCATGATCAACGCCTGCAGAGATTTCCTC
ATGTTAGCCCAGACCCATAGTAAAAAATGGCAAAAGTCACTACAGTATGAAAGAGACCAG
CGTATCCGACTGGAAGAAACCCTCGAGCAGCTGGCGAAGCAGCATAATCACCTGGAGAGG
GCCTTCCGAGGAGCCACGGTGCTGCCGGCAAACACTCCTGGCAATGTGGGTTCTGGTAAA
GATCAGTGCTGCTCTGGCAAAGGGGACATGAGCGATGAAGATGATGAGAATGAATTTTTT
GATGCACCTGAGATCATCACCATGCCTGAAAATTTGGGCCACAAACGTACTGGCAGCAAT
ATCAGTGGAGCCAGCAGTGACATCAGCCTTGATGAACAGTACAAGCATCAGCTGGAGGAG
ACCAAAAAGGAAAAGAGAACCAGAATACCATACAAGCCAAACTATAGCCTCAATTTATGG
AGCATCATGAAGAACTGCATTGGAAAAGAACTCTCTAAGATCCCCATGCCGGTAAACTTT
AATGAGCCCTTGTCCATGCTTCAGCGCCTTACTGAAGATCTGGAATACCATGAGCTGTTA
GACCGAGCTGCAAAATGTGAGAATTCTCTAGAACAGCTCTGTTATGTTGCAGCTTTCACC
GTGTCCTCCTACTCCACTACTGTCTTCCGCACCAGTAAGCCATTCAACCCACTGCTTGGG
GAGACCTTTGAGCTGGACCGATTAGAGGAGAATGGGTACCGATCCCTCTGTGAACAGGTG
AGTCATCATCCCCCTGCTGCTGCGCACCATGCTGAGTCCAAAAATGGCTGGACATTGCGT
CAGGAAATCAAAATCACCAGCAAGTTTCGAGGCAAATACCTCTCCATTATGCCCCTCGGT
ACCATTCATTGTATTTTCCATGCAACTGGGCACCACTACACTTGGAAGAAAGTTACCACA
ACTGTACACAACATTATTGTGGGCAAGTTGTGGATAGATCAGTCTGGCGAAATTGATATT
GTGAATCACAAGACAGGAGACAAGTGTAATCTTAAATTTGTTCCTTATAGCTACTTCTCT
CGGGATGTAGCAAGAAAGGTGACGGGGGAAGTGACAGATCCATCAGGAAAAGTCCACTTT
GCTCTTCTGGGGACGTGGGATGAGAAAATGGAATGTTTCAAAGTACAGCCAGTCATTGGG
GAAAATGGGGGTGATGCTCGACAGAGAGGCCATGAAGCAGAGGAAAGCAGGGTCATGCTG
TGGAAAAGGAATCCTTTACCGAAGAATGCAGAAAACATGTACTACTTCTCAGAGCTTGCT
CTGACTCTCAATGCTTGGGAAAGTGGCACTGCCCCCACAGACAGCCGGTTACGACCTGAC
CAGAGACTGATGGAAAATGGACGCTGGGATGAAGCAAATGCGGAGAAGCAGCGCCTGGAG
GAAAAACAAAGACTTTCCAGAAAGAAGAGAGAAGCGGAAGCTATGAAAGCCACAGAGGAT
GGCACACCATATGATCCCTATAAGGCACTGTGGTTTGAGCGGAAGAAGGACCCTGTTACC
AAGGAGTTAACCCATATTTATAGGGGAGAATACTGGGAGTGTAAAGAAAAACAGGACTGG
AGCTCATGCCCGGACATTTTCTGA
Protein Properties
Number of Residues 807
Molecular Weight 89419.9
Theoretical pI 7.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Oxysterol-binding protein 1
MAATELRGVVGPGPAAIAALGGGGAGPPVVGGGGGRGDAGPGSGAASGTVVAAAAGGPGP
GAGGVAAAGPAPAPPTGGSGGSGAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYY
RSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAK
AKAVKMLAESDESGDEESVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQRSLS
ELESLKLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQ
RIRLEETLEQLAKQHNHLERAFRGATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFF
DAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLW
SIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFT
VSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLR
QEIKITSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDI
VNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMECFKVQPVIG
ENGGDARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWESGTAPTDSRLRPD
QRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVT
KELTHIYRGEYWECKEKQDWSSCPDIF
GenBank ID Protein 10441380
UniProtKB/Swiss-Prot ID P22059
UniProtKB/Swiss-Prot Entry Name OSBP1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF185696
GeneCard ID OSBP
GenAtlas ID OSBP
HGNC ID HGNC:8503
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  10. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  11. Levanon D, Hsieh CL, Francke U, Dawson PA, Ridgway ND, Brown MS, Goldstein JL: cDNA cloning of human oxysterol-binding protein and localization of the gene to human chromosome 11 and mouse chromosome 19. Genomics. 1990 May;7(1):65-74. [PubMed:1970801 ]
  12. Moreira EF, Jaworski C, Li A, Rodriguez IR: Molecular and biochemical characterization of a novel oxysterol-binding protein (OSBP2) highly expressed in retina. J Biol Chem. 2001 May 25;276(21):18570-8. Epub 2001 Jan 26. [PubMed:11278871 ]
  13. Wang PY, Weng J, Anderson RG: OSBP is a cholesterol-regulated scaffolding protein in control of ERK 1/2 activation. Science. 2005 Mar 4;307(5714):1472-6. [PubMed:15746430 ]
  14. Bowden K, Ridgway ND: OSBP negatively regulates ABCA1 protein stability. J Biol Chem. 2008 Jun 27;283(26):18210-7. doi: 10.1074/jbc.M800918200. Epub 2008 May 1. [PubMed:18450749 ]