Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02852
Secondary Accession Numbers
  • 8359
Name Lysophosphatidic acid receptor 1
Synonyms
  1. LPA receptor 1
  2. LPA-1
  3. Lysophosphatidic acid receptor Edg-2
Gene Name LPAR1
Protein Type Enzyme
Biological Properties
General Function Involved in lysosphingolipid and lysophosphatidic acid
Specific Function Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Seems to be coupled to the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Stimulates phospholipase C (PLC) activity in a manner that is dependent on RALA activation
Pathways
  • Lysophosphatidic Acid LPA1 Signalling
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
bioactive lipid receptor activity
lysosphingolipid and lysophosphatidic acid receptor activity
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Cell surface
Gene Properties
Chromosome Location Chromosome:9
Locus 9q31.3
SNPs LPAR1
Gene Sequence
>1095 bp
ATGGCTGCCATCTCTACTTCCATCCCTGTAATTTCACAGCCCCAGTTCACAGCCATGAAT
GAACCACAGTGCTTCTACAACGAGTCCATTGCCTTCTTTTATAACCGAAGTGGAAAGCAT
CTTGCCACAGAATGGAACACAGTCAGCAAGCTGGTGATGGGACTTGGAATCACTGTTTGT
ATCTTCATCATGTTGGCCAACCTATTGGTCATGGTGGCAATCTATGTCAACCGCCGCTTC
CATTTTCCTATTTATTACCTAATGGCTAATCTGGCTGCTGCAGACTTCTTTGCTGGGTTG
GCCTACTTCTATCTCATGTTCAACACAGGACCCAATACTCGGAGACTGACTGTTAGCACA
TGGCTCCTTCGTCAGGGCCTCATTGACACCAGCCTGACGGCATCTGTGGCCAACTTACTG
GCTATTGCAATCGAGAGGCACATTACGGTTTTCCGCATGCAGCTCCACACACGGATGAGC
AACCGGCGGGTAGTGGTGGTCATTGTGGTCATCTGGACTATGGCCATCGTTATGGGTGCT
ATACCCAGTGTGGGCTGGAACTGTATCTGTGATATTGAAAATTGTTCCAACATGGCACCC
CTCTACAGTGACTCTTACTTAGTCTTCTGGGCCATTTTCAACTTGGTGACCTTTGTGGTA
ATGGTGGTTCTCTATGCTCACATCTTTGGCTATGTTCGCCAGAGGACTATGAGAATGTCT
CGGCATAGTTCTGGACCCCGGCGGAATCGGGATACCATGATGAGTCTTCTGAAGACTGTG
GTCATTGTGCTTGGGGCCTTTATCATCTGCTGGACTCCTGGATTGGTTTTGTTACTTCTA
GACGTGTGCTGTCCACAGTGCGACGTGCTGGCCTATGAGAAATTCTTCCTTCTCCTTGCT
GAATTCAACTCTGCCATGAACCCCATCATTTACTCCTACCGCGACAAAGAAATGAGCGCC
ACCTTTAGGCAGATCCTCTGCTGCCAGCGCAGTGAGAACCCCACCGGCCCCACAGAAGGC
TCAGACCGCTCGGCTTCCTCCCTCAACCACACCATCTTGGCTGGAGTTCACAGCAATGAC
CACTCTGTGGTTTAG
Protein Properties
Number of Residues 364
Molecular Weight 41109.0
Theoretical pI 8.6
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 51-75
  • 83-111
  • 126-144
  • 164-189
  • 206-226
  • 259-280
  • 295-315
Protein Sequence
>Lysophosphatidic acid receptor 1
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
GenBank ID Protein 32482013
UniProtKB/Swiss-Prot ID Q92633
UniProtKB/Swiss-Prot Entry Name LPAR1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY322546
GeneCard ID LPAR1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Aziziyeh AI, Li TT, Pape C, Pampillo M, Chidiac P, Possmayer F, Babwah AV, Bhattacharya M: Dual regulation of lysophosphatidic acid (LPA1) receptor signalling by Ral and GRK. Cell Signal. 2009 Jul;21(7):1207-17. doi: 10.1016/j.cellsig.2009.03.011. Epub 2009 Mar 21. [PubMed:19306925 ]
  3. Contos JJ, Ishii I, Chun J: Lysophosphatidic acid receptors. Mol Pharmacol. 2000 Dec;58(6):1188-96. [PubMed:11093753 ]
  4. An S, Dickens MA, Bleu T, Hallmark OG, Goetzl EJ: Molecular cloning of the human Edg2 protein and its identification as a functional cellular receptor for lysophosphatidic acid. Biochem Biophys Res Commun. 1997 Feb 24;231(3):619-22. [PubMed:9070858 ]
  5. Moolenaar WH, Kranenburg O, Postma FR, Zondag GC: Lysophosphatidic acid: G-protein signalling and cellular responses. Curr Opin Cell Biol. 1997 Apr;9(2):168-73. [PubMed:9069262 ]