Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02887
Secondary Accession Numbers
  • 8394
  • HMDBP10745
  • HMDBP10746
Name Sodium- and chloride-dependent taurine transporter
Synonyms
  1. Solute carrier family 6 member 6
Gene Name SLC6A6
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Required for the uptake of taurine. Transports both taurine and beta-alanine which requires sodium ions. Chloride ions are necessary for optimal uptake.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
amino acid transport
cellular amino acid metabolic process
taurine transport
Cellular Component
plasma membrane
integral to membrane
integral to plasma membrane
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
taurine:sodium symporter activity
transmembrane transporter activity
transporter activity
Molecular Function
neurotransmitter:sodium symporter activity
taurine binding
taurine:sodium symporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 3
Locus 3p25.1
SNPs SLC6A6
Gene Sequence
>1863 bp
ATGGCCACCAAGGAGAAGCTGCAGTGTCTGAAAGATTTCCACAAGGACATCCTGAAGCCC
TCACCAGGGAAGAGCCCAGGCACGCGGCCTGAGGACGAGGCTGAGGGAAAACCTCCGCAG
AGGGAGAAGTGGTCTAGCAAGATCGACTTTGTGCTCTCTGTGGCTGGCGGCTTCGTGGGC
TTGGGCAACGTCTGGCGCTTCCCGTACCTCTGCTACAAGAATGGTGGAGGTGCGTTTCTC
ATACCGTATTTTATTTTCCTGTTTGGGAGCGGCCTGCCTGTGTTTTTCTTGGAGATCATC
ATAGGCCAGTACACCTCTGAAGGGGGCATCACCTGCTGGGAAAAGATCTGCCCCTTGTTC
TCTGGTATCGGCTATGCCTCCGTTGTAATTGTGTCCCTCCTGAATGTCTACTACATCGTC
ATCCTGGCCTGGGCCACATACTACCTGTTCCAGTCCTTCCAGAAGGAGCTGCCCTGGGCA
CACTGCAACCACAGCTGGAACACACCTCACTGCATGGAGGACACCATGCGCAAGAACAAG
AGTGTCTGGATCACCATCAGCTCCACCAACTTCACCTCCCCTGTCATCGAGTTCTGGGAG
CGCAACGTGCTGAGCTTGTCCCCTGGAATCGACCACCCAGGCTCTCTGAAATGGGACCTC
GCTCTCTGCCTTCTTTTAGTCTGGCTAGTGTGTTTCTTCTGCATCTGGAAGGGCGTCAGG
TCCACTGGGAAGGTCGTCTACTTCACAGCCACTTTTCCATTCGCCATGCTCCTGGTGCTG
CTGGTCCGAGGGCTGACGCTGCCGGGCGCGGGCGCAGGCATCAAGTTCTATCTGTATCCT
GACATCACCCGCCTTGAGGACCCACAGGTGTGGATTGACGCTGGGACTCAGATATTCTTC
TCTTATGCCATCTGCCTGGGGGCTATGACCTCGCTGGGGAGCTACAACAAGTACAAGTAT
AACTCGTACAGGGACTGTATGCTGCTGGGATGCCTGAACAGTGGTACCAGTTTTGTGTCT
GGCTTCGCAATTTTTTCCATCCTGGGCTTCATGGCACAAGAGCAAGGGGTGGACATTGCT
GATGTGGCTGAGTCAGGTCCTGGCCTGGCCTTCATTGCCTACCCAAAAGCTGTGACAATG
ATGCCGCTGCCCACATTTTGGTCCATTCTTTTTTTTATTATGCTTCTCTTGCTTGGACTG
GATAGCCAGTTTGTTGAAGTTGAAGGACAGATCACATCCTTGGTTGATCTTTACCCATCC
TTCCTAAGGAAGGGTTATCGTCGGGAAATCTTCATCGCCTTCGTGTGTAGCATCAGCTAC
CTGCTGGGGCTGACGATGGTGACGGAGGGTGGCATGTATGTGTTTCAGCTCTTTGACTAC
TATGCAGCTAGCGGTGTATGCCTTTTGTGGGTTGCATTCTTTGAATGTTTTGTTATTGCC
TGGATATATGGAGGTGATAACCTTTATGATGGTATTGAGGACATGATTGGCTATCGGCCC
GGGCCCTGGATGAAGTACAGCTGGGCTGTGATCACTCCAGTTCTCTGTGTTGGATGTTTC
ATCTTCTCGCTCGTCAAGTACGTACCCCTGACCTACAACAAAACATACGTGTACCCCAAC
TGGGCCATTGGGCTGGGCTGGAGCCTGGCCCTTTCCTCCATGCTCTGCGTTCCCTTGGTC
ATCGTCATCCGCCTCTGCCAGACTGAGGGGCCGTTCCTTGTGAGAGTCAAGTACCTGCTG
ACCCCAAGGGAACCCAACCGCTGGGCTGTGGAGCGCGAGGGAGCCACACCTTACAACTCT
CGCACCGTCATGAACGGCGCTCTCGTGAAACCGACCCACATCATTGTGGAGACCATGATG
TGA
Protein Properties
Number of Residues 620
Molecular Weight 69829.405
Theoretical pI 7.393
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium- and chloride-dependent taurine transporter
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVG
LGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLF
SGIGYASVVIVSLLNVYYIVILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNK
SVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVR
STGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDITRLEDPQVWIDAGTQIFF
SYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIA
DVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS
FLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIA
WIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTYNKTYVYPN
WAIGLGWSLALSSMLCVPLVIVIRLCQTEGPFLVRVKYLLTPREPNRWAVEREGATPYNS
RTVMNGALVKPTHIIVETMM
GenBank ID Protein 197276623
UniProtKB/Swiss-Prot ID P31641
UniProtKB/Swiss-Prot Entry Name SC6A6_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001134367.1
GeneCard ID SLC6A6
GenAtlas ID SLC6A6
HGNC ID HGNC:11052
References
General References
  1. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Jhiang SM, Fithian L, Smanik P, McGill J, Tong Q, Mazzaferri EL: Cloning of the human taurine transporter and characterization of taurine uptake in thyroid cells. FEBS Lett. 1993 Mar 1;318(2):139-44. [PubMed:8382624 ]
  4. Ramamoorthy S, Leibach FH, Mahesh VB, Han H, Yang-Feng T, Blakely RD, Ganapathy V: Functional characterization and chromosomal localization of a cloned taurine transporter from human placenta. Biochem J. 1994 Jun 15;300 ( Pt 3):893-900. [PubMed:8010975 ]
  5. Miyamoto Y, Liou GI, Sprinkle TJ: Isolation of a cDNA encoding a taurine transporter in the human retinal pigment epithelium. Curr Eye Res. 1996 Mar;15(3):345-9. [PubMed:8654117 ]