Hmdb loader

Showing Protein Cadherin-1 (HMDBP02891)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP02891
Secondary Accession Numbers
  • 8398
Name Cadherin-1
Synonyms
  1. CAM 120/80
  2. CD324 antigen
  3. E-Cad/CTF1
  4. E-Cad/CTF2
  5. E-Cad/CTF3
  6. E-cadherin
  7. Epithelial cadherin
  8. Uvomorulin
Gene Name CDH1
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function E-Cad/CTF2 promotes non-amyloidogenic degradation of Abeta precursors. Has a strong inhibitory effect on APP C99 and C83 production
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
plasma membrane
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
calcium ion binding
Process
cell adhesion
cellular process
cell-cell adhesion
homophilic cell adhesion
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
  3. Cell junction
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs CDH1
Gene Sequence 
>2649 bp
ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGG
CTCTGCCAGGAGCCGGAGCCCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTTCACG
GTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGTGAATTTTGAAGATTGC
ACCGGTCGACAAAGGACAGCCTATTTTTCCCTCGACACCCGATTCAAAGTGGGCACAGAT
GGTGTGATTACAGTCAAAAGGCCTCTACGGTTTCATAACCCACAGATCCATTTCTTGGTC
TACGCCTGGGACTCCACCTACAGAAAGTTTTCCACCAAAGTCACGCTGAATACAGTGGGG
CACCACCACCGCCCCCCGCCCCATCAGGCCTCCGTTTCTGGAATCCAAGCAGAATTGCTC
ACATTTCCCAACTCCTCTCCTGGCCTCAGAAGACAGAAGAGAGACTGGGTTATTCCTCCC
ATCAGCTGCCCAGAAAATGAAAAAGGCCCATTTCCTAAAAACCTGGTTCAGATCAAATCC
AACAAAGACAAAGAAGGCAAGGTTTTCTACAGCATCACTGGCCAAGGAGCTGACACACCC
CCTGTTGGTGTCTTTATTATTGAAAGAGAAACAGGATGGCTGAAGGTGACAGAGCCTCTG
GATAGAGAACGCATTGCCACATACACTCTCTTCTCTCACGCTGTGTCATCCAACGGGAAT
GCAGTTGAGGATCCAATGGAGATTTTGATCACGGTAACCGATCAGAATGACAACAAGCCC
GAATTCACCCAGGAGGTCTTTAAGGGGTCTGTCATGGAAGGTGCTCTTCCAGGAACCTCT
GTGATGGAGGTCACAGCCACAGACGCGGACGATGATGTGAACACCTACAATGCCGCCATC
GCTTACACCATCCTCAGCCAAGATCCTGAGCTCCCTGACAAAAATATGTTCACCATTAAC
AGGAACACAGGAGTCATCAGTGTGGTCACCACTGGGCTGGACCGAGAGAGTTTCCCTACG
TATACCCTGGTGGTTCAAGCTGCTGACCTTCAAGGTGAGGGGTTAAGCACAACAGCAACA
GCTGTGATCACAGTCACTGACACCAACGATAATCCTCCGATCTTCAATCCCACCACGTAC
AAGGGTCAGGTGCCTGAGAACGAGGCTAACGTCGTAATCACCACACTGAAAGTGACTGAT
GCTGATGCCCCCAATACCCCAGCGTGGGAGGCTGTATACACCATATTGAATGATGATGGT
GGACAATTTGTCGTCACCACAAATCCAGTGAACAACGATGGCATTTTGAAAACAGCAAAG
GGCTTGGATTTTGAGGCCAAGCAGCAGTACATTCTACACGTAGCAGTGACGAATGTGGTA
CCTTTTGAGGTCTCTCTCACCACCTCCACAGCCACCGTCACCGTGGATGTGCTGGATGTG
AATGAAGCCCCCATCTTTGTGCCTCCTGAAAAGAGAGTGGAAGTGTCCGAGGACTTTGGC
GTGGGCCAGGAAATCACATCCTACACTGCCCAGGAGCCAGACACATTTATGGAACAGAAA
ATAACATATCGGATTTGGAGAGACACTGCCAACTGGCTGGAGATTAATCCGGACACTGGT
GCCATTTCCACTCGGGCTGAGCTGGACAGGGAGGATTTTGAGCACGTGAAGAACAGCACG
TACACAGCCCTAATCATAGCTACAGACAATGGTTCTCCAGTTGCTACTGGAACAGGGACA
CTTCTGCTGATCCTGTCTGATGTGAATGACAACGCCCCCATACCAGAACCTCGAACTATA
TTCTTCTGTGAGAGGAATCCAAAGCCTCAGGTCATAAACATCATTGATGCAGACCTTCCT
CCCAATACATCTCCCTTCACAGCAGAACTAACACACGGGGCGAGTGCCAACTGGACCATT
CAGTACAACGACCCAACCCAAGAATCTATCATTTTGAAGCCAAAGATGGCCTTAGAGGTG
GGTGACTACAAAATCAATCTCAAGCTCATGGATAACCAGAATAAAGACCAAGTGACCACC
TTAGAGGTCAGCGTGTGTGACTGTGAAGGGGCCGCTGGCGTCTGTAGGAAGGCACAGCCT
GTCGAAGCAGGATTGCAAATTCCTGCCATTCTGGGGATTCTTGGAGGAATTCTTGCTTTG
CTAATTCTGATTCTGCTGCTCTTGCTGTTTCTTCGGAGGAGAGCGGTGGTCAAAGAGCCC
TTACTGCCCCCAGAGGATGACACCCGGGACAACGTTTATTACTATGATGAAGAAGGAGGC
GGAGAAGAGGACCAGGACTTTGACTTGAGCCAGCTGCACAGGGGCCTGGACGCTCGGCCT
GAAGTGACTCGTAACGACGTTGCACCAACCCTCATGAGTGTCCCCCGGTATCTTCCCCGC
CCTGCCAATCCCGATGAAATTGGAAATTTTATTGATGAAAATCTGAAAGCGGCTGATACT
GACCCCACAGCCCCGCCTTATGATTCTCTGCTCGTGTTTGACTATGAAGGAAGCGGTTCC
GAAGCTGCTAGTCTGAGCTCCCTGAACTCCTCAGAGTCAGACAAAGACCAGGACTATGAC
TACTTGAACGAATGGGGCAATCGCTTCAAGAAGCTGGCTGACATGTACGGAGGCGGCGAG
GACGACTAG
Protein Properties
Number of Residues 882
Molecular Weight 97455.3
Theoretical pI 4.33
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 710-730
Protein Sequence 
>Cadherin-1
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
GenBank ID Protein 4757960
UniProtKB/Swiss-Prot ID P12830
UniProtKB/Swiss-Prot Entry Name CADH1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004360.3
GeneCard ID CDH1
GenAtlas ID CDH1
HGNC ID HGNC:1748
References
General References
  1. Frasa MA, Maximiano FC, Smolarczyk K, Francis RE, Betson ME, Lozano E, Goldenring J, Seabra MC, Rak A, Ahmadian MR, Braga VM: Armus is a Rac1 effector that inactivates Rab7 and regulates E-cadherin degradation. Curr Biol. 2010 Feb 9;20(3):198-208. doi: 10.1016/j.cub.2009.12.053. Epub 2010 Jan 28. [PubMed:20116244 ]
  2. Chanock SJ, Burdett L, Yeager M, Llaca V, Langerod A, Presswalla S, Kaaresen R, Strausberg RL, Gerhard DS, Kristensen V, Perou CM, Borresen-Dale AL: Somatic sequence alterations in twenty-one genes selected by expression profile analysis of breast carcinomas. Breast Cancer Res. 2007;9(1):R5. [PubMed:17224074 ]
  3. Butz S, Kemler R: Distinct cadherin-catenin complexes in Ca(2+)-dependent cell-cell adhesion. FEBS Lett. 1994 Nov 28;355(2):195-200. [PubMed:7982500 ]
  4. Bharti S, Handrow-Metzmacher H, Zickenheiner S, Zeitvogel A, Baumann R, Starzinski-Powitz A: Novel membrane protein shrew-1 targets to cadherin-mediated junctions in polarized epithelial cells. Mol Biol Cell. 2004 Jan;15(1):397-406. Epub 2003 Oct 31. [PubMed:14595118 ]
  5. Bussemakers MJ, van Bokhoven A, Mees SG, Kemler R, Schalken JA: Molecular cloning and characterization of the human E-cadherin cDNA. Mol Biol Rep. 1993 Feb;17(2):123-8. [PubMed:8459805 ]
  6. Oda T, Kanai Y, Oyama T, Yoshiura K, Shimoyama Y, Birchmeier W, Sugimura T, Hirohashi S: E-cadherin gene mutations in human gastric carcinoma cell lines. Proc Natl Acad Sci U S A. 1994 Mar 1;91(5):1858-62. [PubMed:8127895 ]
  7. Rimm DL, Morrow JS: Molecular cloning of human E-cadherin suggests a novel subdivision of the cadherin superfamily. Biochem Biophys Res Commun. 1994 May 16;200(3):1754-61. [PubMed:8185635 ]
  8. Ito K, Okamoto I, Araki N, Kawano Y, Nakao M, Fujiyama S, Tomita K, Mimori T, Saya H: Calcium influx triggers the sequential proteolysis of extracellular and cytoplasmic domains of E-cadherin, leading to loss of beta-catenin from cell-cell contacts. Oncogene. 1999 Nov 25;18(50):7080-90. [PubMed:10597309 ]
  9. Bussemakers MJ, Giroldi LA, van Bokhoven A, Schalken JA: Transcriptional regulation of the human E-cadherin gene in human prostate cancer cell lines: characterization of the human E-cadherin gene promoter. Biochem Biophys Res Commun. 1994 Sep 15;203(2):1284-90. [PubMed:8093045 ]
  10. Yoshiura K, Kanai Y, Ochiai A, Shimoyama Y, Sugimura T, Hirohashi S: Silencing of the E-cadherin invasion-suppressor gene by CpG methylation in human carcinomas. Proc Natl Acad Sci U S A. 1995 Aug 1;92(16):7416-9. [PubMed:7543680 ]
  11. Berx G, Staes K, van Hengel J, Molemans F, Bussemakers MJ, van Bokhoven A, van Roy F: Cloning and characterization of the human invasion suppressor gene E-cadherin (CDH1). Genomics. 1995 Mar 20;26(2):281-9. [PubMed:7601454 ]
  12. Mansouri A, Spurr N, Goodfellow PN, Kemler R: Characterization and chromosomal localization of the gene encoding the human cell adhesion molecule uvomorulin. Differentiation. 1988 Jun;38(1):67-71. [PubMed:3263290 ]
  13. Becker KF, Atkinson MJ, Reich U, Becker I, Nekarda H, Siewert JR, Hofler H: E-cadherin gene mutations provide clues to diffuse type gastric carcinomas. Cancer Res. 1994 Jul 15;54(14):3845-52. [PubMed:8033105 ]
  14. Marambaud P, Shioi J, Serban G, Georgakopoulos A, Sarner S, Nagy V, Baki L, Wen P, Efthimiopoulos S, Shao Z, Wisniewski T, Robakis NK: A presenilin-1/gamma-secretase cleavage releases the E-cadherin intracellular domain and regulates disassembly of adherens junctions. EMBO J. 2002 Apr 15;21(8):1948-56. [PubMed:11953314 ]
  15. Ozawa M, Ringwald M, Kemler R: Uvomorulin-catenin complex formation is regulated by a specific domain in the cytoplasmic region of the cell adhesion molecule. Proc Natl Acad Sci U S A. 1990 Jun;87(11):4246-50. [PubMed:2349235 ]
  16. Steinhusen U, Weiske J, Badock V, Tauber R, Bommert K, Huber O: Cleavage and shedding of E-cadherin after induction of apoptosis. J Biol Chem. 2001 Feb 16;276(7):4972-80. Epub 2000 Nov 13. [PubMed:11076937 ]
  17. Baki L, Marambaud P, Efthimiopoulos S, Georgakopoulos A, Wen P, Cui W, Shioi J, Koo E, Ozawa M, Friedrich VL Jr, Robakis NK: Presenilin-1 binds cytoplasmic epithelial cadherin, inhibits cadherin/p120 association, and regulates stability and function of the cadherin/catenin adhesion complex. Proc Natl Acad Sci U S A. 2001 Feb 27;98(5):2381-6. [PubMed:11226248 ]
  18. Makagiansar IT, Nguyen PD, Ikesue A, Kuczera K, Dentler W, Urbauer JL, Galeva N, Alterman M, Siahaan TJ: Disulfide bond formation promotes the cis- and trans-dimerization of the E-cadherin-derived first repeat. J Biol Chem. 2002 May 3;277(18):16002-10. Epub 2002 Feb 20. [PubMed:11856755 ]
  19. Laprise P, Viel A, Rivard N: Human homolog of disc-large is required for adherens junction assembly and differentiation of human intestinal epithelial cells. J Biol Chem. 2004 Mar 12;279(11):10157-66. Epub 2003 Dec 29. [PubMed:14699157 ]
  20. Serban G, Kouchi Z, Baki L, Georgakopoulos A, Litterst CM, Shioi J, Robakis NK: Cadherins mediate both the association between PS1 and beta-catenin and the effects of PS1 on beta-catenin stability. J Biol Chem. 2005 Oct 28;280(43):36007-12. Epub 2005 Aug 26. [PubMed:16126725 ]
  21. Agiostratidou G, Muros RM, Shioi J, Marambaud P, Robakis NK: The cytoplasmic sequence of E-cadherin promotes non-amyloidogenic degradation of A beta precursors. J Neurochem. 2006 Feb;96(4):1182-8. Epub 2006 Jan 26. [PubMed:16417575 ]
  22. Meng YG, Han WD, Zhao YL, Huang K, Si YL, Wu ZQ, Mu YM: Induction of the LRP16 gene by estrogen promotes the invasive growth of Ishikawa human endometrial cancer cells through the downregulation of E-cadherin. Cell Res. 2007 Oct;17(10):869-80. [PubMed:17893710 ]
  23. Abe K, Takeichi M: EPLIN mediates linkage of the cadherin catenin complex to F-actin and stabilizes the circumferential actin belt. Proc Natl Acad Sci U S A. 2008 Jan 8;105(1):13-9. Epub 2007 Dec 18. [PubMed:18093941 ]
  24. Schubert WD, Urbanke C, Ziehm T, Beier V, Machner MP, Domann E, Wehland J, Chakraborty T, Heinz DW: Structure of internalin, a major invasion protein of Listeria monocytogenes, in complex with its human receptor E-cadherin. Cell. 2002 Dec 13;111(6):825-36. [PubMed:12526809 ]
  25. Berx G, Becker KF, Hofler H, van Roy F: Mutations of the human E-cadherin (CDH1) gene. Hum Mutat. 1998;12(4):226-37. [PubMed:9744472 ]
  26. Kanai Y, Oda T, Tsuda H, Ochiai A, Hirohashi S: Point mutation of the E-cadherin gene in invasive lobular carcinoma of the breast. Jpn J Cancer Res. 1994 Oct;85(10):1035-9. [PubMed:7961105 ]
  27. Risinger JI, Berchuck A, Kohler MF, Boyd J: Mutations of the E-cadherin gene in human gynecologic cancers. Nat Genet. 1994 May;7(1):98-102. [PubMed:8075649 ]
  28. Muta H, Noguchi M, Kanai Y, Ochiai A, Nawata H, Hirohashi S: E-cadherin gene mutations in signet ring cell carcinoma of the stomach. Jpn J Cancer Res. 1996 Aug;87(8):843-8. [PubMed:8797891 ]
  29. Tamura G, Sakata K, Nishizuka S, Maesawa C, Suzuki Y, Iwaya T, Terashima M, Saito K, Satodate R: Inactivation of the E-cadherin gene in primary gastric carcinomas and gastric carcinoma cell lines. Jpn J Cancer Res. 1996 Nov;87(11):1153-9. [PubMed:9045944 ]
  30. Soares P, Berx G, van Roy F, Sobrinho-Simoes M: E-cadherin gene alterations are rare events in thyroid tumors. Int J Cancer. 1997 Jan 6;70(1):32-8. [PubMed:8985087 ]
  31. Guilford P, Hopkins J, Harraway J, McLeod M, McLeod N, Harawira P, Taite H, Scoular R, Miller A, Reeve AE: E-cadherin germline mutations in familial gastric cancer. Nature. 1998 Mar 26;392(6674):402-5. [PubMed:9537325 ]
  32. Yoon KA, Ku JL, Yang HK, Kim WH, Park SY, Park JG: Germline mutations of E-cadherin gene in Korean familial gastric cancer patients. J Hum Genet. 1999;44(3):177-80. [PubMed:10319582 ]
  33. Kim HC, Wheeler JM, Kim JC, Ilyas M, Beck NE, Kim BS, Park KC, Bodmer WF: The E-cadherin gene (CDH1) variants T340A and L599V in gastric and colorectal cancer patients in Korea. Gut. 2000 Aug;47(2):262-7. [PubMed:10896919 ]
  34. Ikonen T, Matikainen M, Mononen N, Hyytinen ER, Helin HJ, Tommola S, Tammela TL, Pukkala E, Schleutker J, Kallioniemi OP, Koivisto PA: Association of E-cadherin germ-line alterations with prostate cancer. Clin Cancer Res. 2001 Nov;7(11):3465-71. [PubMed:11705864 ]
  35. Salahshor S, Hou H, Diep CB, Loukola A, Zhang H, Liu T, Chen J, Iselius L, Rubio C, Lothe RA, Aaltonen L, Sun XF, Lindmark G, Lindblom A: A germline E-cadherin mutation in a family with gastric and colon cancer. Int J Mol Med. 2001 Oct;8(4):439-43. [PubMed:11562785 ]
  36. Oliveira C, Bordin MC, Grehan N, Huntsman D, Suriano G, Machado JC, Kiviluoto T, Aaltonen L, Jackson CE, Seruca R, Caldas C: Screening E-cadherin in gastric cancer families reveals germline mutations only in hereditary diffuse gastric cancer kindred. Hum Mutat. 2002 May;19(5):510-7. [PubMed:11968083 ]
  37. Yabuta T, Shinmura K, Tani M, Yamaguchi S, Yoshimura K, Katai H, Nakajima T, Mochiki E, Tsujinaka T, Takami M, Hirose K, Yamaguchi A, Takenoshita S, Yokota J: E-cadherin gene variants in gastric cancer families whose probands are diagnosed with diffuse gastric cancer. Int J Cancer. 2002 Oct 10;101(5):434-41. [PubMed:12216071 ]
  38. Suriano G, Oliveira C, Ferreira P, Machado JC, Bordin MC, De Wever O, Bruyneel EA, Moguilevsky N, Grehan N, Porter TR, Richards FM, Hruban RH, Roviello F, Huntsman D, Mareel M, Carneiro F, Caldas C, Seruca R: Identification of CDH1 germline missense mutations associated with functional inactivation of the E-cadherin protein in young gastric cancer probands. Hum Mol Genet. 2003 Mar 1;12(5):575-82. [PubMed:12588804 ]