Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02892
Secondary Accession Numbers
  • 8399
Name Gephyrin
Synonyms
  1. Domain E
  2. Domain G
  3. MPT Mo-transferase
  4. MPT adenylyltransferase
  5. Molybdopterin adenylyltransferase
  6. Molybdopterin molybdenumtransferase
Gene Name GPHN
Protein Type Unknown
Biological Properties
General Function Involved in Mo-molybdopterin cofactor biosynthetic process
Specific Function Microtubule-associated protein involved in membrane protein-cytoskeleton interactions. It is thought to anchor the inhibitory glycine receptor (GLYR) to subsynaptic microtubules (By similarity). Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released.
Pathways
  • GABAergic synapse
  • molybdopterin biosynthesis
Reactions
Adenosine triphosphate + Molybdopterin → Pyrophosphate + Adenylyl-molybdopterin details
Adenylyl-molybdopterin + Molybdate → Molybdopterin + Adenosine monophosphate details
GO Classification
Biological Process
molybdopterin cofactor biosynthetic process
water-soluble vitamin metabolic process
establishment of synaptic specificity at neuromuscular junction
Mo-molybdopterin cofactor biosynthetic process
Cellular Component
cytoskeleton
cytoplasm
plasma membrane
cell junction
postsynaptic membrane
Molecular Function
transferase activity
metal ion binding
ATP binding
Process
metabolic process
coenzyme biosynthetic process
molybdopterin cofactor biosynthetic process
cellular metabolic process
biosynthetic process
cellular biosynthetic process
heterocycle biosynthetic process
pteridine and derivative biosynthetic process
cofactor metabolic process
coenzyme metabolic process
mo-molybdopterin cofactor biosynthetic process
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Cytoplasmic side
  4. cytoskeleton
  5. Cell junction
  6. Cell junction
  7. synapse
  8. synapse
  9. postsynaptic cell membrane
Gene Properties
Chromosome Location 14
Locus 14q23.3
SNPs GPHN
Gene Sequence
>2211 bp
ATGGCGACCGAGGGAATGATCCTTACTAACCACGACCATCAAATCCGTGTCGGAGTCCTT
ACAGTGAGTGATAGTTGCTTCAGGAATCTTGCAGAAGACCGCAGTGGGATAAATCTCAAA
GATCTCGTACAAGATCCTTCTTTGTTGGGTGGGACTATATCAGCATACAAGATAGTACCA
GATGAAATAGAAGAAATCAAGGAAACCCTGATAGATTGGTGTGATGAAAAGGAACTTAAT
TTGATATTAACAACTGGAGGAACAGGATTTGCACCACGAGATGTCACTCCAGAGGCCACA
AAAGAAGTAATAGAACGGGAAGCACCAGGGATGGCCCTGGCAATGCTGATGGGATCACTT
AATGTTACACCTCTGGGCATGCTCTCTAGGCCTGTATGTGGAATCAGAGGGAAAACGCTC
ATAATTAACCTGCCAGGTAGCAAGAAAGGATCTCAGGAATGCTTTCAATTCATACTGCCA
GCTCTACCTCATGCCATTGACCTTTTACGTGATGCCATTGTAAAAGTAAAGGAGGTGCAT
GATGAACTTGAAGATTTGCCTTCCCCACCTCCCCCTCTTTCCCCTCCTCCTACTACCAGC
CCCCATAAACAGACAGAAGACAAAGGAGTTCAATGTGAGGAAGAGGAAGAAGAGAAGAAA
GACAGTGGTGTTGCTTCAACAGAAGATAGTTCCTCATCACATATAACTGCAGCAGCCATT
GCTGCCAAGATTCCAGACTCCATCATTTCTCGTGGTGTTCAGGTGCTCCCACGAGACACA
GCCTCCCTCAGCACTACTCCTTCAGAATCGCCTCGTGCTCAGGCTACATCTCGCCTCTCT
ACAGCTTCCTGCCCAACACCAAAAGTCCAGTCCAGGTGCAGCAGCAAGGAGAACATTCTC
AGAGCCAGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGAAGACATCGCATGTCTCCT
TTTCCTCTGACATCTATGGACAAAGCCTTTATCACAGTCCTGGAGATGACTCCGGTGCTT
GGGACAGAAATCATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATAT
GCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGATGGCTATGCTGTCCGAGCT
GCTGATGGCCCAGGAGATCGTTTCATCATTGGGGAATCCCAAGCTGGTGAACAGCCAACT
CAGACAGTAATGCCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGT
GCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGGGAATCAGATGATGGCACT
GAAGAACTTGAAGTGCGAATTCTGGTGCAAGCTCGGCCAGGCCAAGATATCAGACCCATC
GGCCATGACATTAAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCA
GAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAAGTTAATAAGTTTCCAGTG
GTTGCAGTCATGTCAACAGGGAATGAGCTGCTAAATCCTGAAGATGACCTCTTACCAGGG
AAGATTCGAGACAGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCC
ACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTACTCAATGCCTTGAATGAG
GGTATCAGTCGTGCTGATGTCATCATCACATCAGGGGGTGTATCCATGGGGGAAAAGGAC
TATCTCAAGCAGGTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTT
ATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATTGATGGTGTAAGAAAAATA
ATCTTTGCACTACCTGGGAATCCTGTATCGGCTGTGGTCACCTGCAATCTCTTTGTTGTG
CCTGCACTGAGGAAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGG
TTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCATCGGTGTATACTAACTTGG
CATCACCAAGAACCACTACCTTGGGCACAGAGTACAGGTAATCAAATGAGCAGCCGTCTG
ATGAGCATGCGCAGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTG
GAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGACGGCTATGA
Protein Properties
Number of Residues 736
Molecular Weight 79747.635
Theoretical pI 5.431
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Gephyrin
MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVP
DEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSL
NVTPLGMLSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRDAIVKVKEVH
DELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTEDSSSSHITAAAI
AAKIPDSIISRGVQVLPRDTASLSTTPSESPRAQATSRLSTASCPTPKVQSRCSSKENIL
RASHSAVDITKVARRHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVY
AKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVMPGQVMRVTTGAPIPCG
ADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPS
EIGLLATVGVTEVEVNKFPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYP
TINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVF
MKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKAR
LSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYV
ELHKGEVVDVMVIGRL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQX3
UniProtKB/Swiss-Prot Entry Name GEPH_HUMAN
PDB IDs
GenBank Gene ID AF272663
GeneCard ID GPHN
GenAtlas ID GPHN
HGNC ID HGNC:15465
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  5. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  6. Reiss J, Gross-Hardt S, Christensen E, Schmidt P, Mendel RR, Schwarz G: A mutation in the gene for the neurotransmitter receptor-clustering protein gephyrin causes a novel form of molybdenum cofactor deficiency. Am J Hum Genet. 2001 Jan;68(1):208-13. Epub 2000 Nov 28. [PubMed:11095995 ]
  7. David-Watine B: The human gephyrin (GPHN) gene: structure, chromosome localization and expression in non-neuronal cells. Gene. 2001 Jun 27;271(2):239-45. [PubMed:11418245 ]
  8. Schwarz G, Schrader N, Mendel RR, Hecht HJ, Schindelin H: Crystal structures of human gephyrin and plant Cnx1 G domains: comparative analysis and functional implications. J Mol Biol. 2001 Sep 14;312(2):405-18. [PubMed:11554796 ]
  9. Rees MI, Harvey K, Ward H, White JH, Evans L, Duguid IC, Hsu CC, Coleman SL, Miller J, Baer K, Waldvogel HJ, Gibbon F, Smart TG, Owen MJ, Harvey RJ, Snell RG: Isoform heterogeneity of the human gephyrin gene (GPHN), binding domains to the glycine receptor, and mutation analysis in hyperekplexia. J Biol Chem. 2003 Jul 4;278(27):24688-96. Epub 2003 Apr 8. [PubMed:12684523 ]