Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02909
Secondary Accession Numbers
  • 8417
Name Glucokinase regulatory protein
Synonyms
  1. Glucokinase regulator
Gene Name GCKR
Protein Type Enzyme
Biological Properties
General Function Involved in enzyme inhibitor activity
Specific Function Inhibits glucokinase by forming an inactive complex with this enzyme
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 2p23
SNPs GCKR
Gene Sequence
>1878 bp
ATGCCAGGCACAAAACGGTTTCAACATGTCATTGAGACCCCGGAGCCTGGCAAGTGGGAG
TTGTCTGGGTACGAGGCAGCTGTGCCAATCACGGAGAAGTCAAACCCACTGACCCAGGAT
CTAGACAAAGCAGATGCTGAGAACATTGTTCGACTGCTAGGGCAATGTGATGCTGAGATC
TTCCAGGAGGAGGGGCAAGCCCTGTCCACATACCAGAGACTCTACAGCGAATCCATTCTG
ACCACCATGGTACAGGTGGCTGGGAAAGTTCAGGAAGTGCTGAAGGAGCCAGATGGGGGG
CTGGTTGTGCTGAGTGGAGGGGGCACCTCTGGCCGGATGGCATTCCTCATGTCGGTGTCC
TTTAATCAGCTGATGAAAGGTCTGGGACAGAAACCTCTTTACACCTACCTCATTGCAGGT
GGTGACAGGTCTGTGGTGGCCTCTAGGGAGGGGACAGAAGATAGTGCCTTGCACGGGATT
GAGGAACTGAAGAAGGTGGCTGCCGGGAAGAAGAGAGTGATTGTCATTGGCATTTCTGTG
GGACTCTCTGCTCCCTTTGTGGCAGGCCAGATGGACTGCTGCATGAACAACACAGCTGTC
TTCTTGCCAGTCCTGGTTGGCTTCAATCCAGTGAGCATGGCCAGAAATGACCCCATTGAA
GACTGGAGTTCAACATTCCGACAAGTAGCAGAGCGGATGCAGAAAATGCAGGAGAAACAG
AAAGCTTTTGTGCTCAATCCTGCCATCGGGCCCGAGGGTCTCAGCGGCTCCTCCCGGATG
AAAGGTGGAAGTGCCACCAAGATTCTGCTGGAAACCCTGTTATTAGCAGCCCATAAGACT
GTGGACCAGGGCATTGCAGCATCTCAAAGATGCCTCCTGGAAATCTTGCGGACATTTGAG
CGAGCTCATCAGGTGACCTACAGCCAAAGCCCCAAGATTGCCACCCTGATGAAGAGTGTC
AGCACCAGTCTGGAGAAGAAAGGCCACGTGTACCTGGTTGGCTGGCAGACCCTGGGCATC
ATTGCCATCATGGATGGAGTAGAGTGCATCCACACCTTTGGTGCTGATTTCCGAGATGTC
CGTGGCTTTCTCATTGGTGATCACAGTGACATGTTTAACCAGAAGGCTGAGCTCACCAAC
CAGGGTCCCCAGTTCACCTTCTCCCAGGAGGACTTCCTGACTTCCATCCTTCCCTCTCTC
ACGGAAATCGATACTGTGGTCTTCATTTTCACCCTGGATGACAACCTCACGGAGGTGCAG
ACTATAGTGGAGCAGGTGAAAGAGAAGACCAACCACATCCAGGCCCTGGCACACAGCACC
GTGGGTCAGACCTTGCTGATCCCTCTGAAGAAGCTCTTTCCCTCCATCATCAGCATCACA
TGGCCACTGCTTTTCTTTGAATATGAAGGGAACTTCATCCAGAAGTTCCAGCGTGAGCTA
AGCACCAAATGGGTGCTGAATACAGTGAGTACAGGTGCTCATGTGCTTCTTGGTAAGATC
CTACAAAACCACATGTTGGACCTTCGGATTAGCAACTCCAAGCTCTTCTGGCGGGCGCTG
GCCATGCTGCAGCGGTTCTCTGGACAGTCCAAGGCTCGATGCATCGAGAGCCTCCTCCGA
GCGATCCACTTTCCCCAGCCACTGTCAGATGATATTCGGGCTGCTCCCATCTCCTGCCAT
GTCCAGGTTGCACATGAGAAGGAACAGGTGATACCCATCGCCTTGCTGAGCCTCCTATTC
CGGTGCTCGATCACTGAGGCTCAGGCACACCTGGCTGCAGCTCCTTCTGTCTGTGAGGCT
GTCAGGAGTGCTCTTGCTGGGCCAGGTCAGAAGCGCACTGCGGACCCCCTCGAGATCCTA
GAGCCTGACGTTCAGTGA
Protein Properties
Number of Residues 625
Molecular Weight 68700.7
Theoretical pI 6.68
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Glucokinase regulatory protein
MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEI
FQEEGQALSTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDCCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQ
KAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFE
RAHQVTYSQSPKIATLMKSVSTSLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADFRDV
RGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQ
TIVEQVKEKTNHIQALAHSTVGQTLLIPLKKLFPSIISITWPLLFFEYEGNFIQKFQREL
STKWVLNTVSTGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLR
AIHFPQPLSDDIRAAPISCHVQVAHEKEQVIPIALLSLLFRCSITEAQAHLAAAPSVCEA
VRSALAGPGQKRTADPLEILEPDVQ
GenBank ID Protein 62822301
UniProtKB/Swiss-Prot ID Q14397
UniProtKB/Swiss-Prot Entry Name GCKR_HUMAN
PDB IDs Not Available
GenBank Gene ID AC074117
GeneCard ID GCKR
GenAtlas ID GCKR
HGNC ID HGNC:4196
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Warner JP, Leek JP, Intody S, Markham AF, Bonthron DT: Human glucokinase regulatory protein (GCKR): cDNA and genomic cloning, complete primary structure, and chromosomal localization. Mamm Genome. 1995 Aug;6(8):532-6. [PubMed:8589523 ]
  4. Hayward BE, Dunlop N, Intody S, Leek JP, Markham AF, Warner JP, Bonthron DT: Organization of the human glucokinase regulator gene GCKR. Genomics. 1998 Apr 1;49(1):137-42. [PubMed:9570959 ]