Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02913
Secondary Accession Numbers
  • 8421
Name Selenocysteine-specific elongation factor
Synonyms
  1. Elongation factor sec
  2. Eukaryotic elongation factor, selenocysteine-tRNA-specific
Gene Name EEFSEC
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Translation factor necessary for the incorporation of selenocysteine into proteins. It probably replaces EF-Tu for the insertion of selenocysteine directed by the UGA codon. SelB binds GTP and GDP
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasm (Potential)
  2. Nucleus (Potential)
Gene Properties
Chromosome Location Chromosome:3
Locus 3q21.3
SNPs EEFSEC
Gene Sequence
>1791 bp
ATGGCAGGGCGGCGGGTGAACGTGAACGTGGGCGTGCTGGGCCACATCGACAGCGGCAAG
ACGGCGCTGGCGCGGGCGCTAAGCACCACAGCCTCCACCGCCGCCTTTGACAAGCAGCCG
CAGAGCCGCGAGCGCGGCATCACGCTCGATCTGGGCTTCTCGTGCTTCTCGGTGCCGCTG
CCCGCGCGCCTGCGGTCGTCTTTGCCCGAGTTCCAGGCAGCGCCCGAGGCCGAGCCCGAG
CCCGGCGAGCCACTGCTTCAGGTCACGCTGGTCGACTGCCCCGGGCACGCCTCCCTCATC
CGGACCATCATCGGCGGGGCCCAGATCATTGATCTGATGATGCTGGTCATCGATGTGACC
AAGGGGATGCAGACCCAGTCAGCGGAATGCCTTGTGATCGGCCAGATTGCCTGCCAGAAG
CTGGTCGTGGTGCTGAACAAAATAGACCTCTTACCTGAAGGAAAGAGACAGGCAGCAATT
GATAAAATGACCAAGAAAATGCAGAAGACCCTAGAGAACACCAAGTTCCGAGGTGCACCG
ATTATACCCGTGGCGGCCAAGCCGGGGGGACCAGAGGCCCCCGAAACTGAAGCTCCACAG
GGCATTCCAGAGCTCATTGAGCTCCTGACGTCCCAGATTTCCATCCCAACGAGAGACCCC
TCGGGACCGTTCCTCATGTCTGTGGACCACTGTTTCTCCATCAAAGGCCAAGGCACTGTG
ATGACAGGGACCATCCTTTCAGGCTCCATCAGCCTCGGTGACAGTGTGGAGATCCCTGCC
CTCAAGGTGGTGAAGAAGGTGAAGTCCATGCAGATGTTCCACATGCCCATCACTTCAGCC
ATGCAAGGAGACCGGCTGGGCATCTGCGTCACCCAGTTTGACCCTAAGCTGCTGGAGCGC
GGGTTGGTGTGTGCCCCCGAGTCCCTGCACACTGTCCATGCGGCCCTCATCTCTGTGGAA
AAGATACCGTATTTCCGGGGGCCCCTGCAAACCAAGGCCAAGTTCCACATTACAGTGGGC
CATGAAACAGTCATGGGCCGGTTGATGTTCTTCAGTCCTGCTCCAGATAACTTTGACCAG
GAGCCTATACTGGACTCTTTCAACTTCTCTCAAGAATACCTTTTCCAGGAGCAGTACCTG
TCCAAGGATTTGACACCAGCAGTGACAGACAATGATGAGGCCGACAAGAAGGCCGGCCAG
GCCACAGAGGGCCATTGTCCTCGGCAGCAGTGGGCCCTGGTGGAGTTTGAGAAGCCCGTC
ACCTGCCCTCGGCTGTGCCTGGTGATTGGCTCCAGGCTAGATGCGGACATTCACACCAAC
ACGTGCCGGCTAGCCTTCCATGGCATCCTGCTCCACGGGCTAGAGGACAGGAACTACGCC
GACAGCTTCCTGCCCAGGCTGAAGGTGTACAAGCTGAAGCACAAGCATGGCCTTGTGGAG
CGGGCGATGGATGACTACAGTGTGATCGGCCGCTCCCTGTTCAAAAAGGAAACCAACATC
CAGCTCTTCGTGGGGCTCAAGGTGCACTTGTCCACTGGGGAACTGGGCATCATCGACAGT
GCCTTCGGCCAGAGCGGCAAGTTCAAGATCCACATCCCAGGTGGCCTCAGCCCCGAGTCC
AAGAAGATCCTGACACCCGCCCTCAAGAAGCGGGCCCGGGCTGGCCGTGGGGAGGCCACC
AGGCAGGAGGAGAGCGCCGAGCGGAGCGAGCCCTCACAGCATGTGGTGCTCAGCCTGACT
TTCAAGCGTTATGTCTTCGACACCCACAAGCGCATGGTTCAGTCTCCCTGA
Protein Properties
Number of Residues 596
Molecular Weight 65304.1
Theoretical pI 8.48
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Selenocysteine-specific elongation factor
MAGRRVNVNVGVLGHIDSGKTALARALSTTASTAAFDKQPQSRERGITLDLGFSCFSVPL
PARLRSSLPEFQAAPEAEPEPGEPLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVT
KGMQTQSAECLVIGQIACQKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRGAP
IIPVAAKPGGPEAPETEAPQGIPELIELLTSQISIPTRDPSGPFLMSVDHCFSIKGQGTV
MTGTILSGSISLGDSVEIPALKVVKKVKSMQMFHMPITSAMQGDRLGICVTQFDPKLLER
GLVCAPESLHTVHAALISVEKIPYFRGPLQTKAKFHITVGHETVMGRLMFFSPAPDNFDQ
EPILDSFNFSQEYLFQEQYLSKDLTPAVTDNDEADKKAGQATEGHCPRQQWALVEFEKPV
TCPRLCLVIGSRLDADIHTNTCRLAFHGILLHGLEDRNYADSFLPRLKVYKLKHKHGLVE
RAMDDYSVIGRSLFKKETNIQLFVGLKVHLSTGELGIIDSAFGQSGKFKIHIPGGLSPES
KKILTPALKKRARAGRGEATRQEESAERSEPSQHVVLSLTFKRYVFDTHKRMVQSP
GenBank ID Protein 54607086
UniProtKB/Swiss-Prot ID P57772
UniProtKB/Swiss-Prot Entry Name SELB_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_021937.3
GeneCard ID EEFSEC
GenAtlas ID EEFSEC
HGNC ID HGNC:24614
References
General References
  1. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  2. Fagegaltier D, Hubert N, Yamada K, Mizutani T, Carbon P, Krol A: Characterization of mSelB, a novel mammalian elongation factor for selenoprotein translation. EMBO J. 2000 Sep 1;19(17):4796-805. [PubMed:10970870 ]