Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02941
Secondary Accession Numbers
  • 8451
Name P2Y purinoceptor 1
Synonyms
  1. ATP receptor
  2. P2Y1
  3. Purinergic receptor
Gene Name P2RY1
Protein Type Unknown
Biological Properties
General Function Involved in activation of phospholipase C activity by G
Specific Function Receptor for extracellular adenine nucleotides such as ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
nucleotide receptor activity, g-protein coupled
purinergic nucleotide receptor activity, g-protein coupled
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3q25.2
SNPs P2RY1
Gene Sequence
>1122 bp
ATGACCGAGGTGCTGTGGCCGGCTGTCCCCAACGGGACGGACGCTGCCTTCCTGGCCGGT
CCGGGTTCGTCCTGGGGGAACAGCACGGTCGCCTCCACTGCCGCCGTCTCCTCGTCGTTC
AAATGCGCCTTGACCAAGACGGGCTTCCAGTTTTACTACCTGCCGGCTGTCTACATCTTG
GTATTCATCATCGGCTTCCTGGGCAACAGCGTGGCCATCTGGATGTTCGTCTTCCACATG
AAGCCCTGGAGCGGCATCTCCGTGTACATGTTCAATTTGGCTCTGGCCGACTTCTTGTAC
GTGCTGACTCTGCCAGCCCTGATCTTCTACTACTTCAATAAAACAGACTGGATCTTCGGG
GATGCCATGTGTAAACTGCAGAGGTTCATCTTTCATGTGAACCTCTATGGCAGCATCTTG
TTTCTGACATGCATCAGTGCCCACCGGTACAGCGGTGTGGTGTACCCCCTCAAGTCCCTG
GGCCGGCTCAAAAAGAAGAATGCGATCTGTATCAGCGTGCTGGTGTGGCTCATTGTGGTG
GTGGCGATCTCCCCCATCCTCTTCTACTCAGGTACCGGGGTCCGCAAAAACAAAACCATC
ACCTGTTACGACACCACCTCAGACGAGTACCTGCGAAGTTATTTCATCTACAGCATGTGC
ACGACCGTGGCCATGTTCTGTGTCCCCTTGGTGCTGATTCTGGGCTGTTACGGATTAATT
GTGAGAGCTTTGATTTACAAAGATCTGGACAACTCTCCTCTGAGGAGAAAATCGATTTAC
CTGGTAATCATTGTACTGACTGTTTTTGCTGTGTCTTACATCCCTTTCCATGTGATGAAA
ACGATGAACTTGAGGGCCCGGCTTGATTTTCAGACCCCAGCAATGTGTGCTTTCAATGAC
AGGGTTTATGCCACGTATCAGGTGACAAGAGGTCTAGCAAGTCTCAACAGTTGTGTGGAC
CCCATTCTCTATTTCTTGGCGGGAGATACTTTCAGAAGGAGACTCTCCCGAGCCACAAGG
AAAGCTTCTAGAAGAAGTGAGGCAAATTTGCAATCCAAGAGTGAAGACATGACCCTCAAT
ATTTTACCTGAGTTCAAGCAGAATGGAGATACAAGCCTGTGA
Protein Properties
Number of Residues 373
Molecular Weight 42071.1
Theoretical pI 9.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 53-74
  • 88-109
  • 127-147
  • 167-188
  • 219-238
  • 266-285
  • 304-328
Protein Sequence
>P2Y purinoceptor 1
MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVV
VAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
GenBank ID Protein 4505557
UniProtKB/Swiss-Prot ID P47900
UniProtKB/Swiss-Prot Entry Name P2RY1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002563.2
GeneCard ID P2RY1
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  3. Leon C, Vial C, Cazenave JP, Gachet C: Cloning and sequencing of a human cDNA encoding endothelial P2Y1 purinoceptor. Gene. 1996 Jun 1;171(2):295-7. [PubMed:8666290 ]
  4. Ayyanathan K, Webbs TE, Sandhu AK, Athwal RS, Barnard EA, Kunapuli SP: Cloning and chromosomal localization of the human P2Y1 purinoceptor. Biochem Biophys Res Commun. 1996 Jan 26;218(3):783-8. [PubMed:8579591 ]
  5. Janssens R, Communi D, Pirotton S, Samson M, Parmentier M, Boeynaems JM: Cloning and tissue distribution of the human P2Y1 receptor. Biochem Biophys Res Commun. 1996 Apr 25;221(3):588-93. [PubMed:8630005 ]
  6. Jin J, Daniel JL, Kunapuli SP: Molecular basis for ADP-induced platelet activation. II. The P2Y1 receptor mediates ADP-induced intracellular calcium mobilization and shape change in platelets. J Biol Chem. 1998 Jan 23;273(4):2030-4. [PubMed:9442040 ]