Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP02985
Secondary Accession Numbers
  • 8503
Name Large neutral amino acids transporter small subunit 3
Synonyms
  1. L-type amino acid transporter 3
  2. Prostate cancer overexpressed gene 1 protein
  3. Solute carrier family 43 member 1
Gene Name SLC43A1
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Sodium-independent, high affinity transport of large neutral amino acids. Has narrower substrate selectivity compared to SLC7A5 and SLC7A8 and mainly transports branched-chain amino acids and phenylalanine. Plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer
Pathways Not Available
Reactions Not Available
GO Classification
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 11p11.2-p11.1
SNPs SLC43A1
Gene Sequence
>1680 bp
ATGGCCCCCACGCTGCAACAGGCGTACCGGAGGCGCTGGTGGATGGCCTGCACGGCTGTG
CTGGAGAACCTCTTCTTCTCTGCTGTACTCCTGGGCTGGGGCTCCCTGTTGATCATTCTG
AAGAACGAGGGCTTCTATTCCAGCACGTGCCCAGCTGAGAGCAGCACCAACACCACCCAG
GATGAGCAGCGCAGGTGGCCAGGCTGTGACCAGCAGGACGAGATGCTCAACCTGGGCTTC
ACCATTGGTTCCTTCGTGCTCAGCGCCACCACCCTGCCACTGGGGATCCTCATGGACCGC
TTTGGCCCCCGACCCGTGCGGCTGGTTGGCAGTGCCTGCTTCACTGCGTCCTGCACCCTC
ATGGCCCTGGCCTCCCGGGACGTGGAAGCTCTGTCTCCGTTGATATTCCTGGCGCTGTCC
CTGAATGGCTTTGGTGGCATCTGCCTAACGTTCACTTCACTCACGCTGCCCAACATGTTT
GGGAACCTGCGCTCCACGTTAATGGCCCTCATGATTGGCTCTTACGCCTCTTCTGCCATT
ACGTTCCCAGGAATCAAGCTGATCTACGATGCCGGTGTGGCCTTCGTGGTCATCATGTTC
ACCTGGTCTGGCCTGGCCTGCCTTATCTTTCTGAACTGCACCCTCAACTGGCCCATCGAA
GCCTTTCCTGCCCCTGAGGAAGTCAATTACACGAAGAAGATCAAGCTGAGTGGGCTGGCC
CTGGACCACAAGGTGACAGGTGACCTCTTCTACACCCATGTGACCACCATGGGCCAGAGG
CTCAGCCAGAAGGCCCCCAGCCTGGAGGACGGTTCGGATGCCTTCATGTCACCCCAGGAT
GTTCGGGGCACCTCAGAAAACCTTCCTGAGAGGTCTGTCCCCTTACGCAAGAGCCTCTGC
TCCCCCACTTTCCTGTGGAGCCTCCTCACCATGGGCATGACCCAGCTGCGGATCATCTTC
TACATGGCTGCTGTGAACAAGATGCTGGAGTACCTTGTGACTGGTGGCCAGGAGCATGAG
ACAAATGAACAGCAACAAAAGGTGGCAGAGACAGTTGGGTTCTACTCCTCCGTCTTCGGG
GCCATGCAGCTGTTGTGCCTTCTCACCTGCCCCCTCATTGGCTACATCATGGACTGGCGG
ATCAAGGACTGCGTGGACGCCCCAACTCAGGGCACTGTCCTCGGAGATGCCAGGGACGGG
GTTGCTACCAAATCCATCAGACCACGCTACTGCAAGATCCAAAAGCTCACCAATGCCATC
AGTGCCTTCACCCTGACCAACCTGCTGCTTGTGGGTTTTGGCATCACCTGTCTCATCAAC
AACTTACACCTCCAGTTTGTGACCTTTGTCCTGCACACCATTGTTCGAGGTTTCTTCCAC
TCAGCCTGTGGGAGTCTCTATGCTGCAGTGTTCCCATCCAACCACTTTGGGACGCTGACA
GGCCTGCAGTCCCTCATCAGTGCTGTGTTCGCCTTGCTTCAGCAGCCACTTTTCATGGCG
ATGGTGGGACCCCTGAAAGGAGAGCCCTTCTGGGTGAATCTGGGCCTCCTGCTATTCTCA
CTCCTGGGATTCCTGTTGCCTTCCTACCTCTTCTATTACCGTGCCCGGCTCCAGCAGGAG
TACGCCGCCAATGGGATGGGCCCACTGAAGGTGCTTAGCGGCTCTGAGGTGACCGCATAG
Protein Properties
Number of Residues 559
Molecular Weight 61476.2
Theoretical pI 7.73
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 20-40
  • 78-98
  • 105-124
  • 131-151
  • 168-188
  • 191-211
  • 304-324
  • 357-377
  • 419-439
  • 446-466
  • 485-505
  • 510-530
Protein Sequence
>Large neutral amino acids transporter small subunit 3
MAPTLQQAYRRRWWMACTAVLENLFFSAVLLGWGSLLIILKNEGFYSSTCPAESSTNTTQ
DEQRRWPGCDQQDEMLNLGFTIGSFVLSATTLPLGILMDRFGPRPVRLVGSACFTASCTL
MALASRDVEALSPLIFLALSLNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAI
TFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAPEEVNYTKKIKLSGLA
LDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLC
SPTFLWSLLTMGMTQLRIIFYMAAVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFG
AMQLLCLLTCPLIGYIMDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQKLTNAI
SAFTLTNLLLVGFGITCLINNLHLQFVTFVLHTIVRGFFHSACGSLYAAVFPSNHFGTLT
GLQSLISAVFALLQQPLFMAMVGPLKGEPFWVNLGLLLFSLLGFLLPSYLFYYRARLQQE
YAANGMGPLKVLSGSEVTA
GenBank ID Protein 38015938
UniProtKB/Swiss-Prot ID O75387
UniProtKB/Swiss-Prot Entry Name LAT3_HUMAN
PDB IDs Not Available
GenBank Gene ID AB103033
GeneCard ID SLC43A1
GenAtlas ID SLC43A1
HGNC ID HGNC:9225
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Cole KA, Chuaqui RF, Katz K, Pack S, Zhuang Z, Cole CE, Lyne JC, Linehan WM, Liotta LA, Emmert-Buck MR: cDNA sequencing and analysis of POV1 (PB39): a novel gene up-regulated in prostate cancer. Genomics. 1998 Jul 15;51(2):282-7. [PubMed:9722952 ]
  3. Babu E, Kanai Y, Chairoungdua A, Kim DK, Iribe Y, Tangtrongsup S, Jutabha P, Li Y, Ahmed N, Sakamoto S, Anzai N, Nagamori S, Endou H: Identification of a novel system L amino acid transporter structurally distinct from heterodimeric amino acid transporters. J Biol Chem. 2003 Oct 31;278(44):43838-45. Epub 2003 Aug 20. [PubMed:12930836 ]
  4. Chuaqui RF, Englert CR, Strup SE, Vocke CD, Zhuang Z, Duray PH, Bostwick DG, Linehan WM, Liotta LA, Emmert-Buck MR: Identification of a novel transcript up-regulated in a clinically aggressive prostate carcinoma. Urology. 1997 Aug;50(2):302-7. [PubMed:9255310 ]
  5. Skotheim RI, Monni O, Mousses S, Fossa SD, Kallioniemi OP, Lothe RA, Kallioniemi A: New insights into testicular germ cell tumorigenesis from gene expression profiling. Cancer Res. 2002 Apr 15;62(8):2359-64. [PubMed:11956097 ]