Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03014
Secondary Accession Numbers
  • 8539
Name Sodium-dependent phosphate transporter 1
Synonyms
  1. GLVR-1
  2. Gibbon ape leukemia virus receptor 1
  3. Leukemia virus receptor 1 homolog
  4. Phosphate transporter 1
  5. PiT-1
  6. Solute carrier family 20 member 1
Gene Name SLC20A1
Protein Type Unknown
Biological Properties
General Function Involved in inorganic phosphate transmembrane transporter activity
Specific Function Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification. May function as a retroviral receptor as it confers human cells susceptibility to infection to Gibbon Ape Leukemia Virus (GaLV), Simian sarcoma-associated virus (SSAV) and Feline leukemia virus subgroup B (FeLV-B) as well as 10A1 murine leukemia virus (10A1 MLV).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
positive regulation of I-kappaB kinase/NF-kappaB cascade
phosphate-containing compound metabolic process
Cellular Component
integral to plasma membrane
Component
membrane
cell part
Function
inorganic anion transmembrane transporter activity
phosphate transmembrane transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
inorganic phosphate transmembrane transporter activity
transporter activity
anion transmembrane transporter activity
Molecular Function
high affinity inorganic phosphate:sodium symporter activity
inorganic phosphate transmembrane transporter activity
signal transducer activity
receptor activity
sodium:phosphate symporter activity
Process
establishment of localization
transport
phosphate transport
anion transport
inorganic anion transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 2
Locus 2q13
SNPs SLC20A1
Gene Sequence
>2040 bp
ATGGCAACGCTGATTACCAGTACTACAGCTGCTACCGCCGCTTCTGGTCCTTTGGTGGAC
TACCTATGGATGCTCATCCTGGGCTTCATTATTGCATTTGTCTTGGCATTCTCCGTGGGA
GCCAATGATGTAGCAAATTCTTTTGGTACAGCTGTGGGCTCAGGTGTAGTGACCCTGAAG
CAAGCCTGCATCCTAGCTAGCATCTTTGAAACAGTGGGCTCTGTCTTACTGGGGGCCAAA
GTGAGCGAAACCATCCGGAAGGGCTTGATTGACGTGGAGATGTACAACTCGACTCAAGGG
CTGCTGATGGCCGGCTCAGTCAGTGCTATGTTTGGTTCTGCTGTGTGGCAACTCGTGGCT
TCGTTTTTGAAGCTCCCTATTTCTGGAACCCATTGTATTGTTGGTGCAACTATTGGTTTC
TCCCTCGTGGCAAAGGGGCAGGAGGGTGTCAAGTGGTCTGAACTGATAAAAATTGTGATG
TCTTGGTTCGTGTCCCCACTGCTTTCTGGAATTATGTCTGGAATTTTATTCTTCCTGGTT
CGTGCATTCATCCTCCATAAGGCAGATCCAGTTCCTAATGGTTTGCGAGCTTTGCCAGTT
TTCTATGCCTGCACAGTTGGAATAAACCTCTTTTCCATCATGTATACTGGAGCACCGTTG
CTGGGCTTTGACAAACTTCCTCTGTGGGGTACCATCCTCATCTCGGTGGGATGTGCAGTT
TTCTGTGCCCTTATCGTCTGGTTCTTTGTATGTCCCAGGATGAAGAGAAAAATTGAACGA
GAAATAAAGTGTAGTCCTTCTGAAAGCCCCTTAATGGAAAAAAAGAATAGCTTGAAAGAA
GACCATGAAGAAACAAAGTTGTCTGTTGGTGATATTGAAAACAAGCATCCTGTTTCTGAG
GTAGGGCCTGCCACTGTGCCCCTCCAGGCTGTGGTGGAGGAGAGAACAGTCTCATTCAAA
CTTGGAGATTTGGAGGAAGCTCCAGAGAGAGAGAGGCTTCCCAGCGTGGACTTGAAAGAG
GAAACCAGCATAGATAGCACCGTGAATGGTGCAGTGCAGTTGCCTAATGGGAACCTTGTC
CAGTTCAGTCAAGCCGTCAGCAACCAAATAAACTCCAGTGGCCACTACCAGTATCACACC
GTGCATAAGGATTCCGGCCTGTACAAAGAGCTACTCCATAAATTACATCTTGCCAAGGTG
GGAGATTGCATGGGAGACTCCGGTGACAAACCCTTAAGGCGCAATAATAGCTATACTTCC
TATACCATGGCAATATGTGGCATGCCTCTGGATTCATTCCGTGCCAAAGAAGGTGAACAG
AAGGGCGAAGAAATGGAGAAGCTGACATGGCCTAATGCAGACTCCAAGAAGCGAATTCGA
ATGGACAGTTACACCAGTTACTGCAATGCTGTGTCTGACCTTCACTCAGCATCTGAGATA
GACATGAGTGTCAAGGCAGAGATGGGTCTAGGTGACAGAAAAGGAAGTAATGGCTCTCTA
GAAGAATGGTATGACCAGGATAAGCCTGAAGTCTCTCTCCTCTTCCAGTTCCTGCAGATC
CTTACAGCCTGCTTTGGGTCATTCGCCCATGGTGGCAATGACGTAAGCAATGCCATTGGG
CCTCTGGTTGCTTTATATTTGGTTTATGACACAGGAGATGTTTCTTCAAAAGTGGCAACA
CCAATATGGCTTCTACTCTATGGTGGTGTTGGTATCTGTGTTGGTCTGTGGGTTTGGGGA
AGAAGAGTTATCCAGACCATGGGGAAGGATCTGACACCGATCACACCCTCTAGTGGCTTC
AGTATTGAACTGGCATCTGCCCTCACTGTGGTGATTGCATCAAATATTGGCCTTCCCATC
AGTACAACACATTGTAAAGTGGGCTCTGTTGTGTCTGTTGGCTGGCTCCGGTCCAAGAAG
GCTGTTGACTGGCGTCTCTTTCGTAACATTTTTATGGCCTGGTTTGTCACAGTCCCCATT
TCTGGAGTTATCAGTGCTGCCATCATGGCAATCTTCAGATATGTCATCCTCAGAATGTGA
Protein Properties
Number of Residues 679
Molecular Weight 73699.01
Theoretical pI 7.077
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium-dependent phosphate transporter 1
MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLK
QACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVA
SFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLV
RAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAV
FCALIVWFFVCPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSE
VGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLV
QFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTS
YTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEI
DMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIG
PLVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGF
SIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPI
SGVISAAIMAIFRYVILRM
GenBank ID Protein 62822373
UniProtKB/Swiss-Prot ID Q8WUM9
UniProtKB/Swiss-Prot Entry Name S20A1_HUMAN
PDB IDs Not Available
GenBank Gene ID AC079922
GeneCard ID SLC20A1
GenAtlas ID SLC20A1
HGNC ID HGNC:10946
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. O'Hara B, Johann SV, Klinger HP, Blair DG, Rubinson H, Dunn KJ, Sass P, Vitek SM, Robins T: Characterization of a human gene conferring sensitivity to infection by gibbon ape leukemia virus. Cell Growth Differ. 1990 Mar;1(3):119-27. [PubMed:2078500 ]
  6. Palmer G, Manen D, Bonjour JP, Caverzasio J: Characterization of the human Glvr-1 phosphate transporter/retrovirus receptor gene and promoter region. Gene. 1999 Jan 8;226(1):25-33. [PubMed:9889306 ]
  7. Takeuchi Y, Vile RG, Simpson G, O'Hara B, Collins MK, Weiss RA: Feline leukemia virus subgroup B uses the same cell surface receptor as gibbon ape leukemia virus. J Virol. 1992 Feb;66(2):1219-22. [PubMed:1309898 ]
  8. Johann SV, Gibbons JJ, O'Hara B: GLVR1, a receptor for gibbon ape leukemia virus, is homologous to a phosphate permease of Neurospora crassa and is expressed at high levels in the brain and thymus. J Virol. 1992 Mar;66(3):1635-40. [PubMed:1531369 ]
  9. Johann SV, van Zeijl M, Cekleniak J, O'Hara B: Definition of a domain of GLVR1 which is necessary for infection by gibbon ape leukemia virus and which is highly polymorphic between species. J Virol. 1993 Nov;67(11):6733-6. [PubMed:8411375 ]
  10. Olah Z, Lehel C, Anderson WB, Eiden MV, Wilson CA: The cellular receptor for gibbon ape leukemia virus is a novel high affinity sodium-dependent phosphate transporter. J Biol Chem. 1994 Oct 14;269(41):25426-31. [PubMed:7929240 ]
  11. Miller DG, Miller AD: A family of retroviruses that utilize related phosphate transporters for cell entry. J Virol. 1994 Dec;68(12):8270-6. [PubMed:7966619 ]
  12. Kavanaugh MP, Miller DG, Zhang W, Law W, Kozak SL, Kabat D, Miller AD: Cell-surface receptors for gibbon ape leukemia virus and amphotropic murine retrovirus are inducible sodium-dependent phosphate symporters. Proc Natl Acad Sci U S A. 1994 Jul 19;91(15):7071-5. [PubMed:8041748 ]
  13. Jono S, McKee MD, Murry CE, Shioi A, Nishizawa Y, Mori K, Morii H, Giachelli CM: Phosphate regulation of vascular smooth muscle cell calcification. Circ Res. 2000 Sep 29;87(7):E10-7. [PubMed:11009570 ]
  14. Farrell KB, Russ JL, Murthy RK, Eiden MV: Reassessing the role of region A in Pit1-mediated viral entry. J Virol. 2002 Aug;76(15):7683-93. [PubMed:12097582 ]
  15. Cecil DL, Rose DM, Terkeltaub R, Liu-Bryan R: Role of interleukin-8 in PiT-1 expression and CXCR1-mediated inorganic phosphate uptake in chondrocytes. Arthritis Rheum. 2005 Jan;52(1):144-54. [PubMed:15641067 ]