Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03016
Secondary Accession Numbers
  • 8541
Name Xylosyltransferase 1
Synonyms
  1. Peptide O-xylosyltransferase 1
  2. XT-I
  3. XylT-I
  4. Xylosyltransferase I
Gene Name XYLT1
Protein Type Enzyme
Biological Properties
General Function Involved in acetylglucosaminyltransferase activity
Specific Function Catalyzes the first step in biosynthesis of glycosaminoglycan. Transfers D-xylose from UDP-D-xylose to specific serine residues of the core protein. Initial enzyme in the biosynthesis of chondroitin sulfate and dermatan sulfate proteoglycans in fibroblasts and chondrocytes
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
catalytic activity
transferase activity
acetylglucosaminyltransferase activity
udp-glycosyltransferase activity
transferase activity, transferring glycosyl groups
Cellular Location
  1. Golgi apparatus membrane
  2. Endoplasmic reticulum membrane
  3. Single-pass type II membrane protein
  4. Single-pass type II membrane protein
  5. Secreted (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 16p12.3
SNPs XYLT1
Gene Sequence
>2880 bp
ATGGTGGCGGCGCCGTGCGCCCGGAGGCTGGCCCGGCGCTCGCACTCGGCGCTGCTCGCG
GCGCTCACGGTGCTGCTGCTGCAGACGCTGGTCGTGTGGAATTTCAGCAGCCTCGACTCC
GGGGCCGGGGAGCGCCGCGGGGGCGCAGCGGTCGGCGGCGGGGAGCAGCCGCCCCCGGCC
CCGGCCCCGCGCCGGGAGCGCCGGGACCTGCCCGCCGAGCCGGCTGCAGCCCGAGGAGGA
GGAGGAGGCGGCGGCGGAGGAGGAGGAGGACGGGGGCCCCAGGCGCGGGCGCGGGGAGGC
GGCCCCGGAGAACCGCGGGGACAGCAGCCGGCCAGCCGGGGGGCACTGCCCGCCCGGGCT
CTGGATCCACACCCAAGTCCGCTCATCACCCTGGAGACTCAGGATGGCTACTTTTCTCAT
CGGCCGAAAGAGAAAGTGCGAACAGACAGCAACAACGAGAACTCTGTCCCCAAAGACTTT
GAGAATGTCGACAACAGCAACTTCGCACCCAGGACTCAAAAGCAGAAGCACCAGCCTGAG
TTGGCGAAGAAGCCACCGAGTAGACAGAAGGAGCTTTTGAAAAGGAAGCTGGAACAGCAG
GAGAAAGGAAAAGGACATACATTCCCTGGGAAAGGCCCCGGTGAGGTGCTGCCTCCCGGG
GACAGAGCCGCAGCCAACAGCAGCCACGGGAAGGATGTGTCCAGACCGCCTCATGCCAGG
AAAACTGGGGGCAGCTCCCCCGAGACCAAGTATGACCAGCCCCCTAAGTGTGACATCTCA
GGCAAGGAGGCCATCTCTGCCCTGTCCCGTGCTAAGTCCAAGCACTGCCGCCAGGAGATT
GGGGAGACTTACTGCCGCCACAAGTTAGGGCTGCTGATGCCTGAGAAGGTGACTCGGTTC
TGCCCCCTCGAGGGTAAAGCCAACAAGAACGTGCAGTGGGACGAGGACTCCGTGGAGTAC
ATGCCAGCCAACCCGGTCAGAATCGCCTTTGTCCTGGTGGTCCACGGCCGTGCCTCTCGG
CAGTTGCAGCGCATGTTCAAGGCCATCTACCACAAAGACCACTTCTACTACATCCACGTG
GACAAGCGCTCTAATTACCTGCATCGGCAAGTGCTCCAGGTCTCCAGGCAGTACAGCAAT
GTCCGCGTCACCCCCTGGAGAATGGCCACCATCTGGGGAGGAGCCAGCCTCCTGTCCACC
TACCTGCAGAGCATGCGGGACCTCCTGGAGATGACCGACTGGCCCTGGGACTTCTTCATC
AACCTGAGTGCGGCCGACTACCCCATCAGGACAAATGACCAGTTGGTGGCGTTTCTCTCC
CGATACCGAGATATGAATTTCTTGAAGTCACACGGCCGGGACAATGCAAGGTTCATTCGG
AAGCAGGGCCTGGATCGGCTCTTCCTGGAGTGCGACGCTCACATGTGGCGCCTGGGAGAT
CGGCGGATCCCAGAGGGCATTGCCGTGGATGGCGGTTCGGACTGGTTCCTGCTGAACCGG
AGGTTTGTAGAATATGTGACCTTCTCCACAGACGATCTGGTGACCAAGATGAAACAGTTC
TACTCCTACACCCTGCTTCCTGCTGAGTCCTTCTTCCATACGGTCCTGGAGAACAGCCCC
CACTGCGACACCATGGTGGACAACAACCTGCGCATCACCAACTGGAATCGCAAGCTGGGC
TGCAAGTGCCAGTACAAGCACATCGTGGACTGGTGCGGCTGCTCCCCCAATGACTTCAAG
CCGCAGGACTTCCACCGCTTCCAGCAGACAGCCCGGCCTACCTTCTTTGCCCGCAAGTTT
GAAGCCGTGGTGAATCAGGAAATCATTGGGCAGCTGGACTATTACCTGTACGGGAACTAC
CCTGCAGGTACCCCGGGCCTGCGCTCCTACTGGGAGAATGTCTACGATGAGCCTGACGGC
ATCCACAGCCTGAGCGACGTGACACTCACCTTGTACCACTCCTTTGCCCGCCTGGGTCTT
CGACGGGCCGAGACGTCCCTGCACACGGATGGGGAGAACAGCTGCCGATACTACCCAATG
GGCCACCCAGCATCTGTGCACCTCTACTTCCTTGCTGACCGCTTCCAGGGCTTTCTGATC
AAGCATCATGCTACCAATCTGGCTGTGAGCAAACTAGAGACTCTGGAGACCTGGGTGATG
CCGAAAAAAGTCTTCAAGATCGCAAGCCCACCCAGTGACTTTGGGAGGCTTCAGTTTTCC
GAGGTCGGCACTGACTGGGATGCCAAGGAGAGGCTATTCCGCAACTTTGGGGGTCTTCTG
GGGCCCATGGATGAGCCGGTGGGTATGCAGAAGTGGGGGAAGGGACCTAATGTGACCGTG
ACCGTCATTTGGGTGGATCCCGTCAATGTCATCGCAGCCACCTACGACATCCTCATTGAG
TCCACTGCCGAATTCACACACTACAAGCCCCCTTTGAACTTGCCCCTGAGGCCTGGGGTC
TGGACAGTGAAAATTCTCCACCACTGGGTGCCAGTTGCAGAGACCAAATTCCTCGTTGCG
CCTCTGACCTTCTCGAACAGGCAGCCCATCAAACCTGAGGAGGCACTGAAGCTGCACAAT
GGGCCCCTCCGCAATGCCTACATGGAGCAGAGCTTCCAGAGCCTAAACCCCGTCCTCAGC
CTGCCCATCAACCCCGCCCAGGTGGAACAGGCACGGAGGAACGCAGCCTCCACGGGCACA
GCGCTGGAGGGATGGCTGGACTCGTTGGTGGGCGGGATGTGGACTGCCATGGACATCTGT
GCCACGGGCCCCACAGCCTGCCCGGTCATGCAGACCTGCAGCCAGACGGCCTGGAGCTCC
TTCAGCCCTGACCCCAAGTCGGAGCTGGGGGCAGTCAAACCTGATGGCCGGCTCAGGTAG
Protein Properties
Number of Residues 959
Molecular Weight 107568.4
Theoretical pI 9.61
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 18-38
Protein Sequence
>Xylosyltransferase 1
MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPA
PAPRRERRDLPAEPAAARGGGGGGGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARA
LDPHPSPLITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPE
LAKKPPSRQKELLKRKLEQQEKGKGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRPPHAR
KTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRF
CPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHV
DKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFI
NLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGD
RRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSP
HCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF
EAVVNQEIIGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGL
RRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVM
PKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTV
TVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVA
PLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGT
ALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
GenBank ID Protein 28269693
UniProtKB/Swiss-Prot ID Q86Y38
UniProtKB/Swiss-Prot Entry Name XYLT1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_022166.3
GeneCard ID XYLT1
GenAtlas ID XYLT1
HGNC ID HGNC:15516
References
General References
  1. Muller S, Schottler M, Schon S, Prante C, Brinkmann T, Kuhn J, Gotting C, Kleesiek K: Human xylosyltransferase I: functional and biochemical characterization of cysteine residues required for enzymic activity. Biochem J. 2005 Mar 1;386(Pt 2):227-36. [PubMed:15461586 ]
  2. Gotting C, Kuhn J, Zahn R, Brinkmann T, Kleesiek K: Molecular cloning and expression of human UDP-d-Xylose:proteoglycan core protein beta-d-xylosyltransferase and its first isoform XT-II. J Mol Biol. 2000 Dec 8;304(4):517-28. [PubMed:11099377 ]
  3. Kuhn J, Gotting C, Schnolzer M, Kempf T, Brinkmann T, Kleesiek K: First isolation of human UDP-D-xylose: proteoglycan core protein beta-D-xylosyltransferase secreted from cultured JAR choriocarcinoma cells. J Biol Chem. 2001 Feb 16;276(7):4940-7. Epub 2000 Nov 21. [PubMed:11087729 ]
  4. Gotting C, Sollberg S, Kuhn J, Weilke C, Huerkamp C, Brinkmann T, Krieg T, Kleesiek K: Serum xylosyltransferase: a new biochemical marker of the sclerotic process in systemic sclerosis. J Invest Dermatol. 1999 Jun;112(6):919-24. [PubMed:10383739 ]
  5. Gotting C, Kuhn J, Brinkmann T, Kleesiek K: Xylosyltransferase activity in seminal plasma of infertile men. Clin Chim Acta. 2002 Mar;317(1-2):199-202. [PubMed:11814476 ]
  6. Gotting C, Muller S, Schottler M, Schon S, Prante C, Brinkmann T, Kuhn J, Kleesiek K: Analysis of the DXD motifs in human xylosyltransferase I required for enzyme activity. J Biol Chem. 2004 Oct 8;279(41):42566-73. Epub 2004 Aug 4. [PubMed:15294915 ]