Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03047
Secondary Accession Numbers
  • 8576
Name Sodium/hydrogen exchanger 5
Synonyms
  1. NHE-5
  2. Na(+)/H(+) exchanger 5
  3. Solute carrier family 9 member 5
Gene Name SLC9A5
Protein Type Unknown
Biological Properties
General Function Inorganic ion transport and metabolism
Specific Function Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
monovalent cation:hydrogen antiporter activity
sodium:hydrogen antiporter activity
solute:cation antiporter activity
solute:hydrogen antiporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
Process
cation homeostasis
monovalent inorganic cation homeostasis
regulation of ph
sodium ion transport
establishment of localization
transport
biological regulation
transmembrane transport
monovalent inorganic cation transport
ion transport
cation transport
regulation of biological quality
homeostatic process
chemical homeostasis
ion homeostasis
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs SLC9A5
Gene Sequence
>2691 bp
ATGCTGCGCGCCGCCCTGTCCCTGCTCGCGCTGCCCCTGGCGGGGGCGGCCGAAGAGCCC
ACCCAGAAGCCAGAGTCCCCGGGCGAGCCTCCCCCAGGCTTAGAGCTCTTCCGCTGGCAG
TGGCACGAGGTGGAGGCGCCCTACCTGGTGGCCCTGTGGATCCTGGTGGCCAGTCTGGCC
AAAATCGTGTTTCACCTGTCTCGGAAAGTAACATCTCTGGTCCCTGAGAGCTGCCTGCTG
ATTTTGCTGGGCCTGGTGCTAGGGGGAATTGTTTTGGCTGTGGCCAAGAAAGCTGAGTAC
CAGCTGGAGCCAGGCACCTTCTTCCTCTTCCTGCTGCCTCCTATTGTGTTGGACTCAGGC
TATTTCATGCCTAGCAGGCTGTTCTTTGACAACTTGGGTGCCATCCTCACCTATGCCGTG
GTAGGCACACTCTGGAATGCCTTCACAACAGGCGCTGCCCTCTGGGGCTTGCAGCAGGCT
GGACTTGTAGCCCCTAGGGTGCAGGCTGGCTTACTGGACTTCCTGCTGTTTGGGAGCCTC
ATCTCGGCGGTGGACCCCGTGGCCGTGCTAGCTGTCTTTGAGGAGGTGCACGTCAATGAG
ACTCTCTTTATCATCGTCTTTGGCGAGTCCCTGCTCAACGATGCTGTCACCGTGGTGCTG
TACAAGGTCTGCAACTCCTTTGTGGAGATGGGCTCTGCCAATGTGCAGGCCACTGACTAC
CTGAAGGGAGTCGCCTCCCTGTTTGTGGTCAGTCTGGGCGGGGCAGCCGTGGGCTTAGTC
TTTGCCTTCCTCCTGGCCCTGACCACACGCTTCACCAAGCGGGTCCGCATCATCGAGCCG
CTGCTGGTCTTCCTCCTCGCCTACGCAGCCTACCTCACTGCTGAAATGGCCTCGCTCTCC
GCCATTCTTGCGGTGACCATGTGTGGCCTGGGCTGTAAGAAGTACGTGGAGGCCAACATC
TCCCATAAGTCACGCACAACTGTCAAATATACAATGAAGACTCTAGCCAGCTGTGCTGAG
ACCGTGATCTTCATGCTGCTTGGCATCTCAGCCGTGGACTCTTCTAAGTGGGCCTGGGAT
TCTGGGCTGGTGCTGGGCACCCTCATCTTCATCCTGTTCTTCCGAGCCCTCGGCGTAGTC
CTGCAGACCTGGGTGCTGAATCAGTTCCGGCTAGTCCCTCTGGACAAGATTGACCAAGTG
GTGATGTCCTATGGGGGCCTGCGGGGGGCTGTGGCCTTTGCTCTCGTCATCCTACTGGAT
AGGACCAAGGTCCCTGCCAAGGACTACTTTGTAGCCACCACTATTGTAGTGGTCTTCTTC
ACAGTCATCGTGCAGGGCTTGACCATCAAGCCACTGGTCAAATGGCTGAAGGTGAAGAGG
AGTGAGCATCACAAACCCACCCTGAACCAGGAGCTGCATGAACACACTTTTGACCACATT
CTGGCTGCAGTGGAGGACGTTGTGGGGCACCATGGCTACCACTACTGGAGGGACAGGTGG
GAGCAGTTTGACAAGAAATACCTGAGTCAGCTGCTGATGCGACGATCAGCCTACCGCATC
CGGGACCAGATCTGGGATGTGTACTACAGGCTTAACATCCGGGATGCCATCAGCTTTGTG
GACCAGGGAGGCCACGTCTTGTCTTCCACAGGTCTCACTCTGCCTTCTATGCCCAGCCGC
AATTCTGTGGCAGAAACTTCTGTCACCAACCTGCTGAGGGAGAGTGGCAGTGGAGCGTGT
CTGGATCTGCAGGTGATTGACACAGTACGCAGCGGCCGGGATCGTGAGGATGCTGTGATG
CATCATCTGCTCTGCGGAGGCCTCTACAAGCCGCGCCGTAGGTACAAAGCCAGCTGCAGT
CGCCACTTCATCTCAGAGGATGCGCAGGAGCGGCAGGACAAGGAGGTCTTCCAGCAGAAC
ATGAAGCGGCGGCTGGAGTCCTTTAAGTCCACCAAGCACAACATCTGCTTCACCAAGAGC
AAGCCACGACCCCGCAAGACTGGCCGCAGGAAGAAGGATGGTGTGGCGAATGCTGAGGCT
ACAAATGGGAAACATCGAGGCCTGGGCTTTCAGGACACAGCTGCTGTGATATTAACCGTG
GAGTCTGAGGAGGAGGAGGAGGAGAGCGACAGTTCAGAGACAGAGAAGGAGGACGATGAG
GGGATCATCTTTGTGGCTCGTGCCACCAGTGAGGTTCTCCAAGAGGGCAAGGTCTCAGGA
AGCCTTGAGGTGTGCCCAAGCCCACGAATCATTCCCCCCTCCCCAACCTGTGCAGAAAAG
GAGCTCCCCTGGAAGAGTGGGCAGGGGGACCTGGCAGTGTACGTGTCCTCGGAAACCACC
AAGATTGTGCCTGTGGACATGCAGACGGGTTGGAACCAGAGCATCTCATCCCTGGAGAGC
CTAGCGTCCCCTCCCTGTAACCAGGCCCCAATTCTGACCTGCCTGCCTCCCCATCCACGG
GGCACTGAAGAGCCCCAGGTCCCTCTCCACCTACCTTCTGATCCACGCTCTAGCTTCGCC
TTCCCACCGAGCCTGGCCAAGGCTGGCCGCTCTCGCAGTGAGAGCAGCGCTGACCTCCCC
CAGCAGCAGGAGCTGCAGCCCCTCATGGGCCACAAGGACCACACCCATCTCAGCCCAGGC
ACCGCTACCTCCCACTGGTGCATCCAGTTCAACAGAGGCAGCCGGCTGTAG
Protein Properties
Number of Residues 896
Molecular Weight 99010.5
Theoretical pI 7.61
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 46-66
  • 74-94
  • 104-124
  • 135-155
  • 174-194
  • 201-221
  • 247-267
  • 277-297
  • 332-352
  • 361-381
  • 399-419
  • 429-449
Protein Sequence
>Sodium/hydrogen exchanger 5
MLRAALSLLALPLAGAAEEPTQKPESPGEPPPGLELFRWQWHEVEAPYLVALWILVASLA
KIVFHLSRKVTSLVPESCLLILLGLVLGGIVLAVAKKAEYQLEPGTFFLFLLPPIVLDSG
YFMPSRLFFDNLGAILTYAVVGTLWNAFTTGAALWGLQQAGLVAPRVQAGLLDFLLFGSL
ISAVDPVAVLAVFEEVHVNETLFIIVFGESLLNDAVTVVLYKVCNSFVEMGSANVQATDY
LKGVASLFVVSLGGAAVGLVFAFLLALTTRFTKRVRIIEPLLVFLLAYAAYLTAEMASLS
AILAVTMCGLGCKKYVEANISHKSRTTVKYTMKTLASCAETVIFMLLGISAVDSSKWAWD
SGLVLGTLIFILFFRALGVVLQTWVLNQFRLVPLDKIDQVVMSYGGLRGAVAFALVILLD
RTKVPAKDYFVATTIVVVFFTVIVQGLTIKPLVKWLKVKRSEHHKPTLNQELHEHTFDHI
LAAVEDVVGHHGYHYWRDRWEQFDKKYLSQLLMRRSAYRIRDQIWDVYYRLNIRDAISFV
DQGGHVLSSTGLTLPSMPSRNSVAETSVTNLLRESGSGACLDLQVIDTVRSGRDREDAVM
HHLLCGGLYKPRRRYKASCSRHFISEDAQERQDKEVFQQNMKRRLESFKSTKHNICFTKS
KPRPRKTGRRKKDGVANAEATNGKHRGLGFQDTAAVILTVESEEEEEESDSSETEKEDDE
GIIFVARATSEVLQEGKVSGSLEVCPSPRIIPPSPTCAEKELPWKSGQGDLAVYVSSETT
KIVPVDMQTGWNQSISSLESLASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPRSSFA
FPPSLAKAGRSRSESSADLPQQQELQPLMGHKDHTHLSPGTATSHWCIQFNRGSRL
GenBank ID Protein 4071359
UniProtKB/Swiss-Prot ID Q14940
UniProtKB/Swiss-Prot Entry Name SL9A5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF111173
GeneCard ID SLC9A5
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Baird NR, Orlowski J, Szabo EZ, Zaun HC, Schultheis PJ, Menon AG, Shull GE: Molecular cloning, genomic organization, and functional expression of Na+/H+ exchanger isoform 5 (NHE5) from human brain. J Biol Chem. 1999 Feb 12;274(7):4377-82. [PubMed:9933641 ]
  3. Klanke CA, Su YR, Callen DF, Wang Z, Meneton P, Baird N, Kandasamy RA, Orlowski J, Otterud BE, Leppert M, et al.: Molecular cloning and physical and genetic mapping of a novel human Na+/H+ exchanger (NHE5/SLC9A5) to chromosome 16q22.1. Genomics. 1995 Feb 10;25(3):615-22. [PubMed:7759094 ]
  4. Szabo EZ, Numata M, Lukashova V, Iannuzzi P, Orlowski J: beta-Arrestins bind and decrease cell-surface abundance of the Na+/H+ exchanger NHE5 isoform. Proc Natl Acad Sci U S A. 2005 Feb 22;102(8):2790-5. Epub 2005 Feb 7. [PubMed:15699339 ]