Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03072
Secondary Accession Numbers
  • 8606
Name Sodium/hydrogen exchanger 2
Synonyms
  1. NHE-2
  2. Na(+)/H(+) exchanger 2
  3. Solute carrier family 9 member 2
Gene Name SLC9A2
Protein Type Unknown
Biological Properties
General Function Involved in solute:hydrogen antiporter activity
Specific Function Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Seems to play an important role in colonic sodium absorption
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
monovalent cation:hydrogen antiporter activity
sodium:hydrogen antiporter activity
solute:cation antiporter activity
solute:hydrogen antiporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
Process
cation homeostasis
monovalent inorganic cation homeostasis
regulation of ph
sodium ion transport
establishment of localization
transport
biological regulation
transmembrane transport
monovalent inorganic cation transport
ion transport
cation transport
regulation of biological quality
homeostatic process
chemical homeostasis
ion homeostasis
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2q11.2
SNPs SLC9A2
Gene Sequence
>2439 bp
ATGGAACCACTGGGCAACTGGAGGAGCCTGCGGGCGCCACTGCCTCCGATGCTGTTGCTG
CTGCTCCTGCAGGTGGCGGGGCCCGTGGGCGCCCTGGCGGAGACCTTGCTGAACGCGCCG
AGGGCCATGGGCACCAGTTCCAGCCCGCCTAGCCCTGCGAGCGTGGTGGCTCCCGGAACG
ACGCTGTTCGAGGAGAGCCGGCTGCCTGTGTTTACGCTGGATTACCCCCACGTGCAGATC
CCCTTCGAGATCACCCTTTGGATCCTGCTGGCCTCCCTGGCCAAGATTGGCTTCCATCTG
TATCACAAGTTGCCCACAATAGTGCCTGAGAGCTGCCTTCTTATAATGGTTGGACTTCTA
CTAGGTGGGATTATTTTTGGTGTTGATGAGAAGTCTCCCCCTGCAATGAAGACTGATGTA
TTTTTCTTGTACCTCCTCCCACCCATCGTGCTGGATGCCGGCTATTTCATGCCCACTCGC
CCATTCTTTGAGAACATTGGCACGATTTTCTGGTATGCTGTGGTAGGGACACTTTGGAAT
TCCATTGGCATTGGGGTGTCTTTGTTTGGTATCTGCCAGATCGAAGCATTCGGCCTCAGC
GACATCACTTTGCTCCAGAACCTGCTCTTTGGCAGCTTAATCTCAGCTGTCGATCCTGTG
GCTGTGCTTGCTGTCTTTGAGAACATTCACGTCAATGAGCAGCTCTACATCCTGGTCTTT
GGAGAGTCCCTGCTGAATGATGCAGTAACAGTGGTCCTGTACAACTTGTTCAAGTCGTTT
TGCCAGATGAAAACCATTGAGACCATTGATGTGTTTGCAGGAATCGCCAACTTCTTTGTT
GTGGGAATCGGTGGGGTGCTGATTGGCATCTTCTTGGGCTTTATAGCGGCATTTACTACT
CGATTCACCCATAATATCCGAGTGATCGAGCCACTGTTTGTTTTCCTGTACAGTTATTTG
TCCTACATCACAGCTGAAATGTTTCACCTCTCAGGCATCATGGCAATCACTGCTTGTGCA
ATGACTATGAATAAGTACGTAGAAGAAAATGTATCTCAGAAATCCTACACGACCATCAAG
TACTTCATGAAGATGCTGAGCAGTGTCAGCGAAACCTTGATCTTCATCTTCATGGGTGTG
TCTACCGTGGGCAAGAACCACGAGTGGAACTGGGCCTTCGTCTGCTTCACCCTGGCCTTC
TGCCTCATGTGGCGAGCCCTGGGTGTTTTTGTCCTGACTCAGGTCATTAATAGGTTCCGG
ACCATTCCCCTGACCTTTAAGGACCAGTTCATCATTGCCTATGGAGGACTTCGAGGTGCC
ATCTGTTTTGCGTTAGTGTTTCTCCTTCCTGCTGCTGTGTTTCCTCGGAAAAAATTGTTT
ATTACGGCTGCCATTGTTGTCATATTCTTTACTGTCTTCATTCTGGGAATAACTATTCGA
CCACTGGTGGAGTTTCTTGATGTCAAGAGGTCCAATAAGAAACAACAAGCTGTCAGTGAA
GAAATCTATTGTCGGTTGTTTGATCATGTGAAGACTGGAATTGAAGATGTTTGTGGACAT
TGGGGTCACAACTTTTGGAGAGACAAGTTTAAGAAGTTTGATGATAAATATCTGCGGAAG
CTTTTGATTCGGGAAAACCAACCAAAGTCAAGTATTGTATCTTTATATAAAAAGCTTGAA
ATAAAACATGCCATTGAGATGGCAGAGACTGGGATGATAAGTACTGTCCCTACATTTGCA
TCTCTAAATGATTGTCGTGAAGAAAAAATAAGGAAGGTCACGTCCAGTGAAACTGATGAA
ATTCGAGAACTCTTATCAAGAAATCTCTATCAAATCCGTCAGCGAACTTTATCCTACAAC
AGACACAGTCTGACAGCCGACACAAGTGAGAGACAAGCCAAGGAGATTCTGATTCGCCGG
CGACACAGTTTGCGAGAAAGCATTAGGAAGGACAGCAGCTTGAATCGAGAACACAGGGCT
TCCACTTCAACCTCCCGATATTTATCCTTACCTAAAAATACGAAGCTTCCAGAAAAGCTA
CAAAAGAGGAGGACTATTTCTATTGCAGATGGCAATAGCAGCGACTCAGACGCAGATGCC
GGGACCACCGTGCTCAATTTGCAGCCCAGAGCCAGGCGCTTCTTGCCAGAACAGTTCTCC
AAGAAATCCCCCCAGTCCTATAAAATGGAATGGAAGAATGAGGTAGATGTTGATTCTGGC
CGAGATATGCCCAGCACCCCCCCAACACCCCACAGCAGAGAAAAGGGCACCCAGACGTCA
GGCTTACTACAGCAGCCCCTTCTCTCTAAAGACCAGTCTGGCTCAGAGAGGGAAGACAGT
TTGACTGAAGGCATCCCGCCCAAGCCGCCACCACGGCTGGTCTGGAGGGCATCGGAACCT
GGAAGCCGGAAAGCCCGATTTGGGAGTGAGAAGCCTTAA
Protein Properties
Number of Residues 812
Molecular Weight 91518.8
Theoretical pI 9.48
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 107-127
  • 139-159
  • 169-189
  • 209-229
  • 237-257
  • 278-298
  • 308-328
  • 361-381
  • 392-412
  • 459-479
Protein Sequence
>Sodium/hydrogen exchanger 2
MEPLGNWRSLRAPLPPMLLLLLLQVAGPVGALAETLLNAPRAMGTSSSPPSPASVVAPGT
TLFEESRLPVFTLDYPHVQIPFEITLWILLASLAKIGFHLYHKLPTIVPESCLLIMVGLL
LGGIIFGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENIGTIFWYAVVGTLWN
SIGIGVSLFGICQIEAFGLSDITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVF
GESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIANFFVVGIGGVLIGIFLGFIAAFTT
RFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIK
YFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFVCFTLAFCLMWRALGVFVLTQVINRFR
TIPLTFKDQFIIAYGGLRGAICFALVFLLPAAVFPRKKLFITAAIVVIFFTVFILGITIR
PLVEFLDVKRSNKKQQAVSEEIYCRLFDHVKTGIEDVCGHWGHNFWRDKFKKFDDKYLRK
LLIRENQPKSSIVSLYKKLEIKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDE
IRELLSRNLYQIRQRTLSYNRHSLTADTSERQAKEILIRRRHSLRESIRKDSSLNREHRA
STSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFS
KKSPQSYKMEWKNEVDVDSGRDMPSTPPTPHSREKGTQTSGLLQQPLLSKDQSGSEREDS
LTEGIPPKPPPRLVWRASEPGSRKARFGSEKP
GenBank ID Protein 6624113
UniProtKB/Swiss-Prot ID Q9UBY0
UniProtKB/Swiss-Prot Entry Name SL9A2_HUMAN
PDB IDs
GenBank Gene ID AC007239
GeneCard ID SLC9A2
GenAtlas ID SLC9A2
HGNC ID HGNC:11072
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Malakooti J, Dahdal RY, Schmidt L, Layden TJ, Dudeja PK, Ramaswamy K: Molecular cloning, tissue distribution, and functional expression of the human Na(+)/H(+) exchanger NHE2. Am J Physiol. 1999 Aug;277(2 Pt 1):G383-90. [PubMed:10444453 ]