Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03095
Secondary Accession Numbers
  • 8632
Name Sodium/potassium/calcium exchanger 2
Synonyms
  1. Na(+)/K(+)/Ca(2+)-exchange protein 2
  2. Retinal cone Na-Ca+K exchanger
  3. Solute carrier family 24 member 2
Gene Name SLC24A2
Protein Type Unknown
Biological Properties
General Function Inorganic ion transport and metabolism
Specific Function Critical component of the visual transduction cascade, controlling the calcium concentration of outer segments during light and darkness. Light causes a rapid lowering of cytosolic free calcium in the outer segment of both retinal rod and cone photoreceptors and the light-induced lowering of calcium is caused by extrusion via this protein which plays a key role in the process of light adaptation. Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:9
Locus 9p22-p13
SNPs SLC24A2
Gene Sequence
>1986 bp
ATGGATCTGCAACAAAGCACCACCATCACTTCCCTAGAGAAATGGTGTTTGGATGAGTCA
CTGTCTGGCTGCAGAAGACATTATAGTGTCAAGAAAAAACTGAAGTTAATTCGAGTCTTA
GGCCTTTTCATGGGTCTGGTAGCCATTAGCACTGTCTCATTTTCAATCAGTGCCTTTTCT
GAGACAGATACACAGAGCACAGGAGAGGCCAGTGTTGTAAGTGGCCCTAGGGTAGCACAG
GGTTACCATCAGAGAACTCTCTTAGATTTAAATGACAAGATTCTGGATTATACTCCACAG
CCACCTCTTTCTAAGGAAGGCGAGTCTGAGAATAGTACAGATCACGCCCAAGGAGACTAC
CCGAAAGACATCTTTTCCCTTGAGGAGAGAAGAAAAGGTGCGATCATTCTGCATGTCATT
GGAATGATCTACATGTTCATAGCCTTAGCCATTGTCTGTGATGAGTTCTTTGTTCCTTCT
TTGACTGTCATCACTGAAAAACTGGGCATCTCTGATGATGTGGCTGGAGCCACCTTCATG
GCTGCAGGAGGGTCAGCCCCAGAACTTTTCACATCTCTCATAGGGGTATTTATCGCTCAC
AGCAACGTTGGCATAGGCACAATTGTAGGTTCAGCAGTATTCAACATCCTCTTTGTTATT
GGCATGTGTGCTCTGTTTTCTAGAGAAATCTTAAACCTGACATGGTGGCCGCTCTTTCGA
GATGTGTCTTTCTACATTGTTGACTTGATCATGCTGATCATATTTTTCCTGGATAATGTC
ATCATGTGGTGGGAAAGCTTGCTTCTCTTAACAGCTTATTTTTGCTATGTGGTTTTCATG
AAATTCAACGTCCAAGTAGAAAAATGGGTGAAGCAAATGATAAACCGCAATAAGGTCGTC
AAGGTGACAGCACCAGAAGCCCAAGCAAAGCCATCTGCAGCCAGGGACAAGGATGAACCG
ACTCTACCGGCTAAGCCGCGTCTCCAGCGAGGTGGAAGCTCTGCCTCCCTCCACAACAGT
CTCATGAGGAATAGCATCTTCCAACTCATGATACACACCCTTGACCCACTCGCCGAAGAA
CTTGGATCATATGGAAAACTAAAATATTATGACACAATGACTGAAGAAGGGAGGTTCAGA
GAAAAGGCTTCAATTCTCCACAAGATCGCCAAGAAGAAATGTCATGTGGATGAGAACGAG
CGGCAGAATGGGGCTGCCAACCACGTGGAAAAAATTGAGCTTCCAAACAGCACCAGCACA
GATGTTGAAATGACACCATCCAGTGATGCTTCAGAACCTGTACAAAATGGAAATCTCTCC
CACAACATTGAAGGTGCAGAAGCCCAGACCGCTGATGAGGAGGAGGACCAGCCTCTCAGC
CTTGCCTGGCCTTCTGAAACCCGCAAGCAAGTCACGTTTCTGATTGTTTTCCCCATAGTG
TTTCCTCTCTGGATTACGTTACCTGACGTTCGCAAACCTTCATCGAGGAAGTTTTTTCCC
ATCACGTTCTTTGGCTCCATTACCTGGATTGCAGTATTCTCTTACTTGATGGTCTGGTGG
GCGCACCAGGTTGGAGAGACAATTGGCATCAGTGAAGAGATTATGGGCCTGACCATCTTG
GCTGCTGGGACCTCCATCCCTGATCTTATCACCAGTGTCATAGTGGCCCGGAAGGGGTTA
GGGGACATGGCTGTGTCCAGCTCTGTTGGAAGCAACATTTTTGACATCACTGTAGGGCTC
CCACTGCCCTGGCTCCTGTACACCGTCATTCACAGATTCCAGCCAGTGGCTGTCAGCAGC
AATGGCCTTTTCTGTGCCATCGTCCTTCTCTTCATCATGCTGCTCTTCGTCATCCTCTCT
ATCGCCCTCTGCAAGTGGCGAATGAACAAAATCCTGGGCTTCATCATGTTTGGCCTCTAC
TTTGTGTTCCTGGTGGTGAGCGTTCTCCTAGAAGACAGAATTCTTACATGCCCCGTCTCC
ATCTAG
Protein Properties
Number of Residues 661
Molecular Weight 73663.1
Theoretical pI 5.94
Pfam Domain Function
Signals
  • 1-58
Transmembrane Regions
  • 133-153
  • 179-199
  • 205-225
  • 244-264
  • 266-286
  • 470-490
  • 498-518
  • 534-554
  • 570-590
  • 603-623
  • 631-651
Protein Sequence
>Sodium/potassium/calcium exchanger 2
MDLQQSTTITSLEKWCLDESLSGCRRHYSVKKKLKLIRVLGLFMGLVAISTVSFSISAFS
ETDTQSTGEASVVSGPRVAQGYHQRTLLDLNDKILDYTPQPPLSKEGESENSTDHAQGDY
PKDIFSLEERRKGAIILHVIGMIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFM
AAGGSAPELFTSLIGVFIAHSNVGIGTIVGSAVFNILFVIGMCALFSREILNLTWWPLFR
DVSFYIVDLIMLIIFFLDNVIMWWESLLLLTAYFCYVVFMKFNVQVEKWVKQMINRNKVV
KVTAPEAQAKPSAARDKDEPTLPAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLAEE
LGSYGKLKYYDTMTEEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNSTST
DVEMTPSSDASEPVQNGNLSHNIEGAEAQTADEEEDQPLSLAWPSETRKQVTFLIVFPIV
FPLWITLPDVRKPSSRKFFPITFFGSITWIAVFSYLMVWWAHQVGETIGISEEIMGLTIL
AAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPLPWLLYTVIHRFQPVAVSS
NGLFCAIVLLFIMLLFVILSIALCKWRMNKILGFIMFGLYFVFLVVSVLLEDRILTCPVS
I
GenBank ID Protein 6650379
UniProtKB/Swiss-Prot ID Q9UI40
UniProtKB/Swiss-Prot Entry Name NCKX2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF097366
GeneCard ID SLC24A2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Prinsen CF, Szerencsei RT, Schnetkamp PP: Molecular cloning and functional expression of the potassium-dependent sodium-calcium exchanger from human and chicken retinal cone photoreceptors. J Neurosci. 2000 Feb 15;20(4):1424-34. [PubMed:10662833 ]