You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03098
Secondary Accession Numbers
  • 8635
Name Solute carrier family 13 member 4
Synonyms
  1. Na(+)/sulfate cotransporter SUT-1
  2. NaS2
Gene Name SLC13A4
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Sodium/sulfate cotransporter that mediates sulfate reabsorption in the high endothelial venules (HEV)
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
sodium ion transport
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:7
Locus 7q33
SNPs SLC13A4
Gene Sequence
>1881 bp
ATGGGCCTGCTGCAGGGCCTGCTCCGAGTCCGGAAGCTGCTGCTGGTCGTCTGCGTCCCG
CTCCTGCTGCTGCCTCTGCCCGTCCTCCACCCCAGCAGCGAGGCCTCGTGTGCTTACGTG
CTGATCGTGACTGCTGTGTACTGGGTGTCGGAGGCAGTGCCTCTGGGAGCTGCAGCCCTG
GTGCCGGCCTTCCTTTACCCGTTCTTCGGAGTCCTCCGGTCCAATGAGGTGGCGGCGGAG
TACTTCAAGAACACCACGCTGCTGCTGGTGGGGGTCATCTGCGTGGCGGCTGCCGTGGAG
AAGTGGAACCTGCATAAGCGCATTGCTCTGCGCATGGTCTTGATGGCCGGAGCCAAGCCG
GGCATGCTGCTGCTCTGCTTCATGTGCTGTACCACGTTGCTGTCCATGTGGCTGTCCAAC
ACCTCCACCACCGCCATGGTGATGCCCATCGTGGAGGCCGTGCTGCAGGAGCTGGTCAGT
GCTGAGGACGAGCAGCTCGTGGCGGGCAACTCCAACACCGAAGAGGCCGAACCCATCAGT
CTGGATGTAAAGAACAGCCAACCTTCTCTGGAACTCATCTTTGTCAATGAAGAGTCCAAC
GCAGACCTCACCACTCTGATGCACAACGAGAACCTGAATGGTGTGCCCTCGATCACCAAC
CCCATCAAAACTGCAAACCAACACCAGGGCAAGAAGCAACACCCATCCCAGGAAAAGCCA
CAAGTCCTGACCCCCAGCCCCAGGAAGCAGAAGCTGAACAGAAAGTACAGGTCCCACCAT
GACCAGATGATCTGCAAGTGCCTCTCCCTGAGCATATCCTACTCCGCTACCATTGGCGGC
CTGACCACCATCATCGGCACCTCCACCAGCCTCATCTTCCTGGAACACTTCAACAACCAG
TATCCAGCCGCAGAGGTGGTGAACTTTGGCACCTGGTTCCTCTTCAGCTTCCCCATATCC
CTCATCATGCTGGTGGTCAGCTGGTTCTGGATGCACTGGCTGTTCCTGGGCTGCAATTTT
AAAGAGACCTGCTCTCTGAGCAAGAAGAAGAAGACCAAAAGGGAACAGTTGTCAGAGAAG
AGGATCCAAGAAGAATATGAAAAACTGGGAGACATTAGCTACCCAGAAATGGTGACTGGA
TTTTTCTTCATCCTGATGACCGTACTGTGGTTTACCCGGGAGCCTGGCTTTGTCCCTGGC
TGGGATTCTTTCTTTGAAAAGAAAGGCTACCGTACTGATGCCACAGTCTCTGTCTTCCTT
GGCTTCCTCCTCTTCCTCATTCCAGCGAAGAAGCCCTGCTTTGGGAAAAAGAATGATGGA
GAGAACCAGGAGCACTCACTGGGGACCGAGCCCATCATCACGTGGAAGGACTTCCAGAAG
ACCATGCCCTGGGAGATTGTCATTCTGGTTGGGGGAGGCTATGCTCTGGCTTCTGGTAGC
AAGAGCTCTGGCCTCTCTACATGGATTGGGAACCAGATGTTGTCCCTGAGCAGCCTCCCA
CCGTGGGCTGTCACCCTGCTGGCATGCATCCTCGTGTCCATTGTCACTGAGTTTGTGAGC
AACCCAGCAACCATCACCATCTTCCTGCCCATCCTGTGCAGCCTGTCTGAAACGCTGCAC
ATTAACCCCCTCTACACCCTGATCCCAGTCACCATGTGCATCTCCTTTGCAGTGATGCTG
CCTGTGGGCAATCCCCCTAATGCCATCGTCTTCAGCTATGGGCACTGCCAGATCAAAGAT
ATGGTGAAAGCTGGCCTGGGAGTCAACGTTATTGGACTGGTGATAGTAATGGTGGCCATC
AACACCTGGGGAGTTAGCCTCTTCCACCTGGACACTTACCCAGCATGGGCGAGGGTCAGC
AACATCACTGATCAAGCCTAA
Protein Properties
Number of Residues 626
Molecular Weight 69357.9
Theoretical pI 7.45
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 13-33
  • 52-72
  • 77-97
  • 113-133
  • 274-294
  • 309-329
  • 372-392
  • 414-434
  • 466-486
  • 499-519
  • 543-563
  • 590-610
Protein Sequence
>Solute carrier family 13 member 4
MGLLQGLLRVRKLLLVVCVPLLLLPLPVLHPSSEASCAYVLIVTAVYWVSEAVPLGAAAL
VPAFLYPFFGVLRSNEVAAEYFKNTTLLLVGVICVAAAVEKWNLHKRIALRMVLMAGAKP
GMLLLCFMCCTTLLSMWLSNTSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPIS
LDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKP
QVLTPSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGGLTTIIGTSTSLIFLEHFNNQ
YPAAEVVNFGTWFLFSFPISLIMLVVSWFWMHWLFLGCNFKETCSLSKKKKTKREQLSEK
RIQEEYEKLGDISYPEMVTGFFFILMTVLWFTREPGFVPGWDSFFEKKGYRTDATVSVFL
GFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWEIVILVGGGYALASGS
KSSGLSTWIGNQMLSLSSLPPWAVTLLACILVSIVTEFVSNPATITIFLPILCSLSETLH
INPLYTLIPVTMCISFAVMLPVGNPPNAIVFSYGHCQIKDMVKAGLGVNVIGLVIVMVAI
NTWGVSLFHLDTYPAWARVSNITDQA
GenBank ID Protein 31795546
UniProtKB/Swiss-Prot ID Q9UKG4
UniProtKB/Swiss-Prot Entry Name S13A4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_012450.2
GeneCard ID SLC13A4
GenAtlas ID SLC13A4
HGNC ID HGNC:15827
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  4. Girard JP, Baekkevold ES, Feliu J, Brandtzaeg P, Amalric F: Molecular cloning and functional analysis of SUT-1, a sulfate transporter from human high endothelial venules. Proc Natl Acad Sci U S A. 1999 Oct 26;96(22):12772-7. [PubMed:10535998 ]
  5. Markovich D, Regeer RR, Kunzelmann K, Dawson PA: Functional characterization and genomic organization of the human Na(+)-sulfate cotransporter hNaS2 gene (SLC13A4). Biochem Biophys Res Commun. 2005 Jan 28;326(4):729-34. [PubMed:15607730 ]