Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03114
Secondary Accession Numbers
  • 8656
  • HMDBP03487
Name Cationic amino acid transporter 3
Synonyms
  1. CAT-3
  2. CAT3
  3. Cationic amino acid transporter y+
  4. Solute carrier family 7 member 3
Gene Name SLC7A3
Protein Type Unknown
Biological Properties
General Function Involved in transport
Specific Function Mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
active transmembrane transporter activity
transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
transporter activity
Process
establishment of localization
transport
amine transport
amino acid transport
transmembrane transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SLC7A3
Gene Sequence
>1860 bp
ATGCCGTGGCAAGCATTTCGCAGATTTGGTCAAAAGCTGGTACGCAGACGTACACTGGAG
TCAGGCATGGCTGAGACTCGCCTTGCCAGATGCCTAAGCACCCTGGATTTAGTGGCCCTG
GGTGTGGGCAGCACATTGGGTGCAGGCGTGTATGTCCTAGCTGGCGAGGTGGCCAAAGAT
AAAGCAGGGCCATCCATTGTGATCTGCTTTTTGGTGGCTGCCCTGTCTTCTGTGTTGGCT
GGGCTGTGCTATGCGGAGTTTGGTGCCCGGGTTCCCCGTTCTGGTTCGGCATATCTCTAC
AGCTATGTCACTGTGGGTGAACTCTGGGCCTTCACCACTGGCTGGAACCTCATCCTCTCC
TATGTCATTGGTACAGCCAGTGTGGCCCGGGCCTGGAGCTCTGCTTTTGACAACCTGATT
GGGAACCACATCTCTAAGACTCTGCAGGGGTCCATTGCACTGCACGTGCCCCATGTCCTT
GCAGAATATCCAGATTTCTTTGCTTTGGGCCTCGTGTTGCTGCTCACTGGATTGTTGGCT
CTCGGGGCTAGTGAGTCGGCCCTGGTTACCAAAGTGTTCACAGGCGTGAACCTTTTGGTT
CTTGGGTTCGTCATGATCTCTGGCTTCGTTAAGGGGGACGTGCACAACTGGAAGCTCACA
GAAGAGGACTACGAATTGGCCATGGCTGAACTCAATGACACCTATAGCTTGGGTCCTCTG
GGCTCTGGAGGATTTGTGCCTTTCGGCTTCGAGGGAATTCTCCGTGGAGCAGCGACCTGT
TTCTATGCATTTGTTGGTTTCGACTGTATTGCTACCACTGGAGAAGAAGCCCAGAATCCC
CAGCGTTCCATCCCGATGGGCATTGTGATCTCACTGTCTGTCTGCTTTTTGGCGTATTTT
GCTGTCTCTTCTGCACTCACCCTGATGATGCCTTACTACCAGCTTCAGCCTGAGAGCCCT
TTGCCTGAGGCATTTCTCTACATTGGATGGGCTCCTGCCCGCTATGTTGTGGCTGTTGGC
TCCCTCTGTGCTCTTTCTACCAGCCTCCTGGGCTCCATGTTCCCCATGCCTCGGGTGATC
TACGCGATGGCAGAGGATGGCCTCCTGTTCCGTGTACTTGCTCGGATCCACACCGGCACA
CGCACCCCAATCATAGCCACCGTGGTCTCTGGCATTATTGCAGCATTCATGGCATTCCTC
TTCAAACTCACTGATCTTGTGGACCTCATGTCAATTGGGACCCTGCTTGCTTACTCCCTG
GTGTCGATTTGTGTTCTCATCCTCAGGTATCAACCTGATCAGGAGACAAAGACTGGGGAA
GAAGTGGAGTTGCAGGAGGAGGCAATAACTACTGAATCAGAGAAGTTGACCCTATGGGGA
CTATTTTTCCCACTCAACTCCATCCCCACTCCACTCTCTGGCCAAATTGTCTATGTTTGT
TCCTCATTGCTTGCTGTCCTGCTGACTGCTCTTTGCCTGGTGCTGGCCCAGTGGTCAGTT
CCATTGCTTTCTGGAGACCTGCTGTGGACTGCAGTGGTTGTGCTGCTCCTGCTGCTCATT
ATTGGGATCATTGTGGTCATCTGGAGACAGCCACAGAGTTCCACTCCCCTTCACTTTAAG
GTGCCTGCTTTGCCTCTCCTCCCACTAATGAGCATCTTTGTGAATATTTACCTTATGATG
CAGATGACAGCTGGTACCTGGGCCCGATTTGGGGTCTGGATGCTGATTGGCTTTGCTATC
TACTTCGGCTATGGGATCCAGCACAGCCTGGAAGAGATTAAGAGTAACCAACCCTCACGC
AAGTCTAGAGCCAAAACTGTAGACCTTGATCCCGGCACTCTCTATGTCCACTCAGTTTGA
Protein Properties
Number of Residues 619
Molecular Weight 67168.3
Theoretical pI 6.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 37-57
  • 62-82
  • 108-128
  • 163-183
  • 192-212
  • 234-254
  • 286-306
  • 336-356
  • 383-403
  • 407-427
  • 476-496
  • 507-527
  • 541-561
  • 570-590
Protein Sequence
>Cationic amino acid transporter 3
MPWQAFRRFGQKLVRRRTLESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKD
KAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILS
YVIGTASVARAWSSAFDNLIGNHISKTLQGSIALHVPHVLAEYPDFFALGLVLLLTGLLA
LGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYELAMAELNDTYSLGPL
GSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYF
AVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVI
YAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSL
VSICVLILRYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQIVYVC
SSLLAVLLTALCLVLAQWSVPLLSGDLLWTAVVVLLLLLIIGIIVVIWRQPQSSTPLHFK
VPALPLLPLMSIFVNIYLMMQMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSR
KSRAKTVDLDPGTLYVHSV
GenBank ID Protein 17224957
UniProtKB/Swiss-Prot ID Q8WY07
UniProtKB/Swiss-Prot Entry Name CTR3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF320612
GeneCard ID SLC7A3
GenAtlas ID SLC7A3
HGNC ID HGNC:11061
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  4. Vekony N, Wolf S, Boissel JP, Gnauert K, Closs EI: Human cationic amino acid transporter hCAT-3 is preferentially expressed in peripheral tissues. Biochemistry. 2001 Oct 16;40(41):12387-94. [PubMed:11591158 ]