Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03125
Secondary Accession Numbers
  • 8669
Name Sodium- and chloride-dependent GABA transporter 2
Synonyms
  1. GAT-2
  2. Solute carrier family 6 member 13
Gene Name SLC6A13
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
Pathways
  • GABAergic synapse
Reactions Not Available
GO Classification
Biological Process
neurotransmitter secretion
transmembrane transport
Cellular Component
plasma membrane
integral to membrane
integral to plasma membrane
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
organic acid:sodium symporter activity
sodium:amino acid symporter activity
gamma-aminobutyric acid:sodium symporter activity
transporter activity
organic acid transmembrane transporter activity
Molecular Function
gamma-aminobutyric acid:sodium symporter activity
neurotransmitter binding
neurotransmitter:sodium symporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 12
Locus 12p13.3
SNPs SLC6A13
Gene Sequence
>1809 bp
ATGGATAGCAGGGTCTCAGGCACAACCAGTAATGGAGAGACAAAACCAGTGTATCCAGTC
ATGGAAAAGAAGGAGGAAGATGGCACCCTGGAGCGGGGGCACTGGAACAACAAGATGGAG
TTTGTGCTGTCAGTGGCTGGGGAGATCATTGGCTTAGGCAACGTCTGGAGGTTTCCCTAT
CTCTGCTACAAAAATGGGGGAGGTGCCTTCTTCATCCCCTACCTCGTCTTCCTCTTTACC
TGTGGCATTCCTGTCTTCCTTCTGGAGACAGCACTAGGCCAGTACACTAGCCAGGGAGGC
GTCACAGCCTGGAGGAAGATCTGCCCCATCTTTGAGGGCATTGGCTATGCCTCCCAGATG
ATCGTCATCCTCCTCAACGTCTACTACATCATTGTGTTGGCCTGGGCCCTGTTCTACCTC
TTCAGCAGCTTCACCATCGACCTGCCCTGGGGCGGCTGCTACCATGAGTGGAACACAGAA
CACTGTATGGAGTTCCAGAAGACCAACGGCTCCCTGAATGGTACCTCTGAGAATGCCACC
TCTCCTGTCATCGAGTTCTGGGAGCGGCGGGTCTTGAAGATCTCTGATGGGATCCAGCAC
CTGGGGGCCCTGCGCTGGGAGCTGGCTCTGTGCCTCCTGCTGGCCTGGGTCATCTGCTAC
TTCTGCATCTGGAAGGGGGTGAAGTCCACAGGCAAGGTGGTGTACTTCACGGCCACATTT
CCTTACCTCATGCTGGTGGTCCTGTTAATTCGAGGGGTGACGTTGCCTGGGGCAGCCCAA
GGAATTCAGTTTTACCTGTACCCAAACCTCACGCGTCTGTGGGATCCCCAGGTGTGGATG
GATGCAGGCACCCAGATATTCTTCTCCTTCGCCATCTGTCTTGGGTGCCTGACAGCCCTG
GGCAGCTACAACAAGTACCACAACAACTGCTACAGGGACTGCATCGCCCTCTGCTTCCTC
AACAGCGGCACCAGCTTTGTGGCCGGCTTTGCCATCTTCTCCATCCTGGGCTTCATGTCT
CAGGAGCAGGGGGTGCCCATTTCTGAGGTGGCCGAGTCAGGCCCTGGCCTGGCTTTCATC
GCTTACCCGCGGGCTGTGGTGATGCTGCCCTTCTCTCCTCTCTGGGCCTGCTGTTTCTTC
TTCATGGTCGTTCTCCTGGGACTGGATAGCCAGTTTGTGTGTGTAGAAAGCCTGGTGACA
GCGCTGGTGGACATGTACCCTCACGTGTTCCGCAAGAAGAACCGGAGGGAAGTCCTCATC
CTTGGAGTATCTGTCGTCTCCTTCCTTGTGGGGCTGATCATGCTCACAGAGGGCGGAATG
TACGTGTTCCAGCTCTTTGACTACTATGCGGCCAGTGGCATGTGCCTCCTGTTCGTGGCC
ATCTTCGAGTCCCTCTGTGTGGCTTGGGTTTACGGAGCCAAGCGCTTCTACGACAACATC
GAAGACATGATTGGGTACAGGCCATGGCCTCTTATCAAATACTGTTGGCTCTTCCTCACA
CCAGCTGTGTGCACAGCCACCTTTCTCTTCTCCCTGATAAAGTACACTCCGCTGACCTAC
AACAAGAAGTACACGTACCCGTGGTGGGGCGATGCCCTGGGCTGGCTCCTGGCTCTGTCC
TCCATGGTCTGCATTCCTGCCTGGAGCCTCTACAGACTCGGAACCCTCAAGGGCCCCTTC
AGAGAGAGAATCCGTCAGCTCATGTGCCCAGCCGAGGACCTGCCCCAGCGGAACCCAGCA
GGACCCTCGGCTCCCGCCACCCCCAGGACCTCACTGCTCAGACTCACAGAGCTAGAGTCT
CACTGCTAG
Protein Properties
Number of Residues 602
Molecular Weight 57564.995
Theoretical pI 7.712
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium- and chloride-dependent GABA transporter 2
MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQM
IVILLNVYYIIVLAWALFYLFSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENAT
SPVIEFWERRVLKISDGIQHLGALRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLI
LGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKRFYDNI
EDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMVCIPAWSLYRLGTLKGPFRERIRQLMCPAEDLPQRNPAGPSAPATPRTSLLRLTELES
HC
GenBank ID Protein 189069259
UniProtKB/Swiss-Prot ID Q9NSD5
UniProtKB/Swiss-Prot Entry Name S6A13_HUMAN
PDB IDs Not Available
GenBank Gene ID AK313511
GeneCard ID SLC6A13
GenAtlas ID SLC6A13
HGNC ID HGNC:11046
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gong Y, Zhang M, Cui L, Minuk GY: Sequence and chromosomal assignment of a human novel cDNA: similarity to gamma-aminobutyric acid transporter. Can J Physiol Pharmacol. 2001 Dec;79(12):977-84. [PubMed:11824941 ]
  4. Christiansen B, Meinild AK, Jensen AA, Brauner-Osborne H: Cloning and characterization of a functional human gamma-aminobutyric acid (GABA) transporter, human GAT-2. J Biol Chem. 2007 Jul 6;282(27):19331-41. Epub 2007 May 14. [PubMed:17502375 ]