Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03126
Secondary Accession Numbers
  • 8671
Name Sodium/potassium/calcium exchanger 1
Synonyms
  1. Na(+)/K(+)/Ca(2+)-exchange protein 1
  2. Retinal rod Na-Ca+K exchanger
Gene Name SLC24A1
Protein Type Unknown
Biological Properties
General Function Involved in calcium, potassium:sodium antiporter activity
Specific Function Critical component of the visual transduction cascade, controlling the calcium concentration of outer segments during light and darkness. Light causes a rapid lowering of cytosolic free calcium in the outer segment of both retinal rod and cone photoreceptors and the light-induced lowering of calcium is caused by extrusion via this protein which plays a key role in the process of light adaptation. Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
solute:cation antiporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
cation:cation antiporter activity
calcium:cation antiporter activity
calcium, potassium:sodium antiporter activity
transporter activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
multicellular organismal process
system process
neurological system process
sensory perception
sensory perception of light stimulus
visual perception
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 15q22
SNPs SLC24A1
Gene Sequence
>3300 bp
ATGGGGAAATTGATCAGGATGGGGCCGCAAGAGAGGTGGTTACTCCGGACAAAGCGGCTT
CATTGGAGTCGCCTCCTCTTCTTACTGGGAATGTTGATCATCGGTTCTACTTATCAGCAC
CTTAGGAGACCCCGGGGCCTTTCCTCATTGTGGGCAGCAGTCTCTTCTCATCAGCCTATA
AAACTGGCCAGTCGGGACCTCTCCAGTGAAGAGATGATGATGATGAGCAGCAGCCCTTCA
AAACCTAGCTCCGAAATGGGGGGTAAGATGCTGGTACCCCAAGCCTCAGTGGGCAGTGAT
GAAGCAACACTGAGCATGACAGTGGAGAATATCCCCAGTATGCCTAAAAGAACAGCCAAG
ATGATCCCAACAACAACCAAGAATAATTACAGCCCAACAGCAGCAGGTACAGAAAGAAGG
AAGGAAGACACCCCAACATCCAGTAGAACACTGACTTACTACACCTCAACTTCAAGCAGA
CAAATAGTAAAAAAGTATACCCCAACACCCAGGGGAGAAATGAAGAGCTACAGCCCAACT
CAAGTGAGGGAAAAGGTGAAGTATACTCCTTCCCCACGTGGTAGAAGAGTAGGCACTTAC
GTGCCGTCCACATTCATGACAATGGAAACAAGCCATGCGATCACCCCCAGGACAACAGTG
AAAGACAGTGACATTACAGCAACCTATAAAATACTCGAAACCAACTCTCTTAAGAGAATA
ATGGAGGAAACCACCCCAACCACTCTCAAGGGAATGTTTGATAGCACCCCAACTTTTCTG
ACACATGAGGTAGAAGCAAACGTCTTGACTTCTCCAAGGAGCGTCATGGAAAAAAACAAC
CTGTTTCCCCCCAGAAGAGTGGAAAGTAACAGCTCAGCCCATCCCTGGGGGTTAGTGGGA
AAGAGCAACCCGAAGACTCCCCAGGGAACAGTCCTGTTGCATACCCCAGCCACCTCTGAG
GGGCAGGTGACAATAAGCACCATGACAGGCAGCAGCCCAGCAGAAACCAAAGCCTTCACT
GCTGCCTGGAGTCTTAGGAATCCTTCACCCAGGACCAGTGTATCAGCCATCAAAACAGCC
CCAGCCATAGTCTGGAGGCTGGCAAAGAAACCTTCCACAGCACCCAGCACCTCAACAACC
CCTACGGTCAGGGCAAAGCTGACCATGCAGGTCCATCACTGTGTGGTTGTGAAGCCAACC
CCAGCCATGCTCACCACTCCCTCCCCAAGCCTCACAACAGCCCTGCTCCCAGAGGAGCTC
AGTCCTAGTCCCTCAGTGCTGCCTCCCAGCTTGCCAGACCTCCACCCCAAGGGAGAGTAC
CCCCCAGATCTGTTCAGTGTGGAGGAGCGGCGGCAGGGCTGGGTGGTCCTGCACGTTTTT
GGCATGATGTATGTGTTTGTGGCCTTGGCCATTGTTTGCGACGAGTACTTCGTTCCAGCC
CTGGGTGTCATCACAGACAAGCTGCAGATCTCCGAGGATGTGGCAGGCGCCACATTCATG
GCTGCTGGAGGCTCTGCTCCTGAGCTCTTCACCTCCCTCATCGGTGTCTTCATTTCCCAC
AGCAACGTGGGCATTGGTACCATTGTGGGCTCTGCTGTGTTCAACATTCTCTTTGTCATT
GGCACTTGTTCCCTCTTCTCCCGAGAGATCCTCAACCTCACCTGGTGGCCCTTATTCCGT
GATGTCTCCTTCTACATCCTTGACCTGATAATGCTCATCCTCTTCTTCCTGGACAGCCTC
ATTGCCTGGTGGGAGAGCCTGCTGCTGCTGCTGGCCTATGCCTTCTATGTGTTCACCATG
AAGTGGAACAAGCATATCGAGGTCTGGGTGAAGGAGCAGCTCAGCAGGAGGCCAGTGGCC
AAGGTCATGGCCTTAGAAGACCTCAGCAAGCCGGGCGATGGGGCCATTGCGGTGGATGAG
CTACAGGATAACAAGAAGCTGAAGCTCCCGTCCTTGCTGACCCGAGGGAGCAGCTCGACC
TCTCTGCACAACAGCACCATCCGCAGCACCATCTACCAGCTCATGCTCCACAGCCTGGAC
CCCCTGAGGGAAGTTCGCCTTGCCAAGGAGAAGGAGGAGGAGAGCTTGAATCAAGGGGCC
AGAGCCCAACCCCAGGCCAAAGCAGAAAGCAAACCAGAAGAGGAGGAGCCAGCCAAGCTC
CCTGCGGTCACGGTCACACCAGCCCCTGTTCCAGACATCAAGGGAGATCAGAAGGAGAAT
CCAGGCGGTCAGGAAGATGTGGCTGAGGCCGAGAGCACAGGTGAAATGCCAGGCGAAGAG
GGCGAAACTGCTGGTGAAGGTGAAACTGAAGAGAAAAGTGGAGGTGAAACTCAACCAGAA
GGTGAAGGTGAAACTGAAACACAAGGAAAAGGAGAAGAATGTGAAGATGAAAATGAAGCA
GAAGGAAAAGGAGACAATGAAGGTGAAGATGAGGGTGAAATCCACGCAGAAGATGGTGAA
ATGAAAGGTAATGAAGGTGAAACTGAAAGCCAGGAACTCAGTGCTGAAAATCACGGTGAA
GCCAAAAATGATGAGAAAGGTGTAGAAGATGGAGGGGGAAGTGATGGAGGGGATAGCGAA
GAGGAGGAAGAGGAGGAGGAAGAGCAGGAGGAAGAGGAGGAGGAGGAAGAGCAGGAGGAA
GAGGAGGAGGAGGAGGAGGAAGAGGAGGAGAAGGGAAATGAAGAGCCTCTGTCCCTGGAC
TGGCCTGAAACCAGGCAGAAGCAGGCCATTTACCTCTTCCTTCTGCCCATCGTGTTCCCA
CTGTGGCTGACAGTCCCCGACGTCCGAAGGCAGGAGTCTAGGAAGTTTTTTGTTTTCACC
TTCCTGGGATCTATCATGTGGATAGCCATGTTCTCATACCTCATGGTGTGGTGGGCTCAC
CAGGTTGGTGAAACAATAGGGATTTCTGAAGAGATCATGGGCCTGACAATCCTTGCAGCA
GGCACATCAATTCCTGACCTCATCACCAGTGTGATTGTCGCTCGAAAAGGCCTGGGAGAC
ATGGCTGTGTCAAGCTCTGTGGGCAGTAACATATTTGATATCACTGTGGGCTTGCCTGTT
CCTTGGTTGCTTTTCTCTCTTATCAATGGATTACAGCCAGTTCCAGTCAGCAGCAATGGC
TTGTTTTGTGCAATTGTTTTGCTTTTTCTCATGCTTCTGTTTGTGATCTCTTCAATTGCG
TCATGTAAATGGAGAATGAACAAGATCCTGGGCTTCACAATGTTCCTCCTTTACTTTGTA
TTCCTGATAATCAGTGTGATGTTAGAAGATCGAATCATATCCTGTCCTGTATCTGTCTGA
Protein Properties
Number of Residues 1099
Molecular Weight 121373.1
Theoretical pI 4.6
Pfam Domain Function
Signals
  • 1-
Transmembrane Regions
  • 453-473
  • 498-518
  • 523-543
  • 564-584
  • 586-606
  • 908-928
  • 936-956
  • 972-992
  • 1011-1031
  • 1040-1060
  • 1069-1089
Protein Sequence
>Sodium/potassium/calcium exchanger 1
MGKLIRMGPQERWLLRTKRLHWSRLLFLLGMLIIGSTYQHLRRPRGLSSLWAAVSSHQPI
KLASRDLSSEEMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAK
MIPTTTKNNYSPTAAGTERRKEDTPTSSRTLTYYTSTSSRQIVKKYTPTPRGEMKSYSPT
QVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRI
MEETTPTTLKGMFDSTPTFLTHEVEANVLTSPRSVMEKNNLFPPRRVESNSSAHPWGLVG
KSNPKTPQGTVLLHTPATSEGQVTISTMTGSSPAETKAFTAAWSLRNPSPRTSVSAIKTA
PAIVWRLAKKPSTAPSTSTTPTVRAKLTMQVHHCVVVKPTPAMLTTPSPSLTTALLPEEL
SPSPSVLPPSLPDLHPKGEYPPDLFSVEERRQGWVVLHVFGMMYVFVALAIVCDEYFVPA
LGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVI
GTCSLFSREILNLTWWPLFRDVSFYILDLIMLILFFLDSLIAWWESLLLLLAYAFYVFTM
KWNKHIEVWVKEQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSST
SLHNSTIRSTIYQLMLHSLDPLREVRLAKEKEEESLNQGARAQPQAKAESKPEEEEPAKL
PAVTVTPAPVPDIKGDQKENPGGQEDVAEAESTGEMPGEEGETAGEGETEEKSGGETQPE
GEGETETQGKGEECEDENEAEGKGDNEGEDEGEIHAEDGEMKGNEGETESQELSAENHGE
AKNDEKGVEDGGGSDGGDSEEEEEEEEEQEEEEEEEEQEEEEEEEEEEEEKGNEEPLSLD
WPETRQKQAIYLFLLPIVFPLWLTVPDVRRQESRKFFVFTFLGSIMWIAMFSYLMVWWAH
QVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPV
PWLLFSLINGLQPVPVSSNGLFCAIVLLFLMLLFVISSIASCKWRMNKILGFTMFLLYFV
FLIISVMLEDRIISCPVSV
GenBank ID Protein 4759128
UniProtKB/Swiss-Prot ID O60721
UniProtKB/Swiss-Prot Entry Name NCKX1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004727.2
GeneCard ID SLC24A1
GenAtlas ID SLC24A1
HGNC ID HGNC:10975
References
General References
  1. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. [PubMed:9734811 ]
  2. Tucker JE, Winkfein RJ, Murthy SK, Friedman JS, Walter MA, Demetrick DJ, Schnetkamp PP: Chromosomal localization and genomic organization of the human retinal rod Na-Ca+K exchanger. Hum Genet. 1998 Oct;103(4):411-4. [PubMed:9856482 ]
  3. Tucker JE, Winkfein RJ, Cooper CB, Schnetkamp PP: cDNA cloning of the human retinal rod Na-Ca + K exchanger: comparison with a revised bovine sequence. Invest Ophthalmol Vis Sci. 1998 Feb;39(2):435-40. [PubMed:9478004 ]
  4. McKiernan CJ, Friedlander M: The retinal rod Na(+)/Ca(2+),K(+) exchanger contains a noncleaved signal sequence required for translocation of the N terminus. J Biol Chem. 1999 Dec 31;274(53):38177-82. [PubMed:10608890 ]