You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03129
Secondary Accession Numbers
  • 8675
Name Arachidonate 12-lipoxygenase, 12R-type
Synonyms
  1. 12R-LOX
  2. 12R-lipoxygenase
  3. Epidermis-type lipoxygenase 12
Gene Name ALOX12B
Protein Type Unknown
Biological Properties
General Function Involved in metal ion binding
Specific Function Converts arachidonic acid to 12R- hydroperoxyeicosatetraenoic acid (12R-HPETE)
Pathways
  • Acetaminophen Action Pathway
  • Acetylsalicylic Acid Action Pathway
  • Antipyrine Action Pathway
  • Antrafenine Action Pathway
  • Arachidonic Acid Metabolism
  • Bromfenac Action Pathway
  • Carprofen Action Pathway
  • Celecoxib Action Pathway
  • Diclofenac Action Pathway
  • Diflunisal Action Pathway
  • Etodolac Action Pathway
  • Etoricoxib Action Pathway
  • Fenoprofen Action Pathway
  • Flurbiprofen Action Pathway
  • Ibuprofen Action Pathway
  • Indomethacin Action Pathway
  • Ketoprofen Action Pathway
  • Ketorolac Action Pathway
  • Leukotriene C4 Synthesis Deficiency
  • Lornoxicam Action Pathway
  • Lumiracoxib Action Pathway
  • Magnesium salicylate Action Pathway
  • Mefenamic Acid Action Pathway
  • Meloxicam Action Pathway
  • Nabumetone Action Pathway
  • Naproxen Action Pathway
  • Nepafenac Action Pathway
  • Oxaprozin Action Pathway
  • Phenylbutazone Action Pathway
  • Piroxicam Action Pathway
  • Rofecoxib Action Pathway
  • Salicylate-sodium Action Pathway
  • Salicylic Acid Action Pathway
  • Salsalate Action Pathway
  • Sulindac Action Pathway
  • Suprofen Action Pathway
  • Tenoxicam Action Pathway
  • Tiaprofenic Acid Action Pathway
  • Tolmetin Action Pathway
  • Trisalicylate-choline Action Pathway
  • Valdecoxib Action Pathway
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
transition metal ion binding
iron ion binding
lipoxygenase activity
oxidoreductase activity
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
oxidation reduction
unsaturated fatty acid metabolic process
icosanoid metabolic process
leukotriene metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.1
SNPs ALOX12B
Gene Sequence
>2106 bp
ATGGCCACCTACAAAGTCAGGGTGGCCACAGGCACCGACCTCTTGTCGGGAACACGGGAC
TCCATCTCACTGACCATTGTGGGGACACAAGGAGAGAGCCATAAGCAGCTGCTGAACCAC
TTTGGGAGAGACTTTGCAACTGGGGCGGTGGGCCAGTACACCGTGCAGTGCCCTCAGGAC
CTGGGTGAGCTCATCATCATCCGCCTGCACAAAGAGCGGTACGCCTTCTTCCCCAAGGAC
CCTTGGTACTGCAACTATGTGCAGATCTGTGCCCCCAACGGCCGTATCTACCACTTCCCC
GCCTACCAGTGGATGGATGGCTACGAGACCCTGGCACTCCGGGAGGCCACAGGAAAGACA
ACAGCAGATGACTCGCTCCCCGTCCTCCTGGAGCACAGAAAAGAGGAGATCAGAGCCAAG
CAGGACTTCTACCACTGGCGAGTCTTTCTTCCTGGCCTGCCCAGCTATGTGCACATTCCC
AGTTACCGCCCTCCGGTGCGGAGGCATCGCAACCCCAACCGGCCTGAGTGGAATGGCTAT
ATTCCGGGATTCCCAATTCTCATCAACTTTAAGGCCACCAAGTTCCTGAACTTAAATCTC
CGCTACTCCTTCCTCAAGACGGCCTCCTTCTTCGTCCGCCTGGGGCCCATGGCACTGGCT
TTCAAAGTCCGCGGCCTGTTGGACTGCAAACATTCGTGGAAGAGGCTGAAGGACATTAGG
AAAATTTTCCCTGGCAAGAAATCTGTCGTCTCCGAGTACGTGGCCGAGCACTGGGCAGAG
GACACCTTCTTTGGGTACCAGTACCTCAACGGCGTCAACCCCGGCCTGATCCGCCGCTGC
ACGCGGATCCCAGACAAGTTCCCCGTCACAGACGACATGGTGGCTCCGTTCCTGGGCGAG
GGAACGTGCTTGCAAGCGGAGCTGGAGAAGGGGAACATTTACCTGGCCGACTACCGCATC
ATGGAGGGCATCCCCACCGTGGAGCTCAGCGGCCGGAAGCAGCACCACTGCGCCCCCCTC
TGCCTGCTGCACTTTGGACCCGAGGGCAAGATGATGCCCATCGCCATCCAGCTCAGCCAG
ACCCCTGGGCCAGATTGCCCCATCTTCCTGCCCAGTGATTCTGAGTGGGACTGGCTGCTA
GCCAAGACGTGGGTACGCTATGCGGAGTTCTACAGCCACGAGGCCATCGCCCACCTGCTG
GAGACACACCTCATTGCTGAGGCCTTCTGCCTGGCCTTGCTGAGGAACCTGCCCATGTGC
CACCCCCTCTACAAGCTCCTCATCCCCCATACCCGATACACCGTCCAGATCAACAGCATT
GGCCGGGCCGTTCTCCTCAATGAGGGGGGGCTCTCTGCCAAGGGCATGTCCCTGGGCGTG
GAAGGCTTTGCTGGGGTGATGGTACGGGCTCTGTCGGAGCTCACCTATGACAGCCTCTAC
CTCCCCAATGACTTTGTGGAGCGTGGGGTCCAGGACCTGCCTGGATATTACTACCGCGAT
GACAGCTTGGCGGTGTGGAATGCACTGGAGAAGTATGTGACGGAGATCATCACCTATTAT
TACCCGAGTGACGCAGCCGTGGAGGGTGATCCGGAATTGCAGTCTTGGGTGCAGGAAATA
TTTAAAGAGTGCCTCCTGGGGCGGGAGAGCTCAGGCTTCCCTAGGTGCTTGCGAACCGTG
CCTGAGCTGATCCGATATGTCACTATAGTCATCTACACCTGCTCTGCCAAGCACGCTGCT
GTCAACACAGGCCAGATGGAGTTCACCGCCTGGATGCCCAACTTCCCAGCGTCCATGCGG
AATCCACCGATTCAGACTAAGGGGCTGACCACTCTGGAGACCTTCATGGACACGTTGCCG
GATGTGAAGACCACGTGCATCACGCTGCTGGTGCTCTGGACCCTCAGCCGAGAGCCTGAC
GACAGGCGGCCCCTGGGACACTTCCCGGACATTCACTTCGTGGAGGAGGCCCCGCGGAGG
AGCATAGAGGCGTTCCGCCAGCGCCTGAACCAGATCTCACACGACATCCGCCAGCGCAAC
AAGTGCCTTCCCATCCCCTACTACTACCTGGACCCGGTGCTGATTGAGAACAGCATTTCT
ATTTAG
Protein Properties
Number of Residues 701
Molecular Weight 80354.9
Theoretical pI 7.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Arachidonate 12-lipoxygenase, 12R-type
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD
LGELIIIRLHKERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKT
TADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGY
IPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGE
GTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQ
TPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMC
HPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLY
LPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEI
FKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMR
NPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRR
SIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O75342
UniProtKB/Swiss-Prot Entry Name LX12B_HUMAN
PDB IDs Not Available
GenBank Gene ID AF038461
GeneCard ID ALOX12B
GenAtlas ID ALOX12B
HGNC ID HGNC:430
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Krieg P, Marks F, Furstenberger G: A gene cluster encoding human epidermis-type lipoxygenases at chromosome 17p13.1: cloning, physical mapping, and expression. Genomics. 2001 May 1;73(3):323-30. [PubMed:11350124 ]
  3. Boeglin WE, Kim RB, Brash AR: A 12R-lipoxygenase in human skin: mechanistic evidence, molecular cloning, and expression. Proc Natl Acad Sci U S A. 1998 Jun 9;95(12):6744-9. [PubMed:9618483 ]
  4. Sun D, McDonnell M, Chen XS, Lakkis MM, Li H, Isaacs SN, Elsea SH, Patel PI, Funk CD: Human 12(R)-lipoxygenase and the mouse ortholog. Molecular cloning, expression, and gene chromosomal assignment. J Biol Chem. 1998 Dec 11;273(50):33540-7. [PubMed:9837935 ]
  5. Jobard F, Lefevre C, Karaduman A, Blanchet-Bardon C, Emre S, Weissenbach J, Ozguc M, Lathrop M, Prud'homme JF, Fischer J: Lipoxygenase-3 (ALOXE3) and 12(R)-lipoxygenase (ALOX12B) are mutated in non-bullous congenital ichthyosiform erythroderma (NCIE) linked to chromosome 17p13.1. Hum Mol Genet. 2002 Jan 1;11(1):107-13. [PubMed:11773004 ]