You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03133
Secondary Accession Numbers
  • 8680
  • HMDBP03505
Name Excitatory amino acid transporter 1
Synonyms
  1. GLAST-1
  2. Sodium-dependent glutamate/aspartate transporter 1
  3. Solute carrier family 1 member 3
Gene Name SLC1A3
Protein Type Unknown
Biological Properties
General Function Involved in sodium:dicarboxylate symporter activity
Specific Function Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
organic acid transmembrane transporter activity
carboxylic acid transmembrane transporter activity
dicarboxylic acid transmembrane transporter activity
sodium:dicarboxylate symporter activity
Process
establishment of localization
transport
organic acid transport
carboxylic acid transport
dicarboxylic acid transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5p13
SNPs SLC1A3
Gene Sequence
>1629 bp
ATGACTAAAAGCAATGGAGAAGAGCCCAAGATGGGGGGCAGGATGGAGAGATTCCAGCAG
GGAGTCCGTAAACGCACACTTTTGGCCAAGAAGAAAGTGCAGAACATTACAAAGGAGGAT
GTTAAAAGTTACCTGTTTCGGAATGCTTTTGTGCTGCTCACAGTCACCGCTGTCATTGTG
GGTACAATCCTTGGATTTACCCTCCGACCATACAGAATGAGCTACCGGGAAGTCAAGTAC
TTCTCCTTTCCTGGGGAACTTCTGATGAGGATGTTACAGATGCTGGTCTTACCACTTATC
ATCTCCAGTCTTGTCACAGGAATGGCGGCGCTAGATAGTAAGGCATCAGGGAAGATGGGA
ATGCGAGCTGTAGTCTATTATATGACTACCACCATCATTGCTGTGGTGATTGGCATAATC
ATTGTCATCATCATCCATCCTGGGAAGGGCACAAAGGAAAACATGCACAGAGAAGGCAAA
ATTGTACGAGTGACAGCTGCAGATGCCTTCCTGGACTTGATCAGGAACATGTTCCCTCCA
AATCTGGTAGAAGCCTGCTTTAAACAGTTTAAAACCAACTATGAGAAGAGAAGCTTTAAA
GTGCCCATCCAGGCCAACGAAACGCTTGTGGGTGCTGTGATAAACAATGTGTCTGAGGCC
ATGGAGACTCTTACCCGAATCACAGAGGAGCTGGTCCCAGTTCCAGGATCTGTGAATGGA
GTCAATGCCCTGGGTCTAGTTGTCTTCTCCATGTGCTTCGGTTTTGTGATTGGAAACATG
AAGGAACAGGGGCAGGCCCTGAGAGAGTTCTTTGATTCTCTTAACGAAGCCATCATGAGA
CTGGTAGCAGTAATAATGTGGTATGCCCCCGTGGGTATTCTCTTCCTGATTGCTGGGAAG
ATTGTGGAGATGGAAGACATGGGTGTGATTGGGGGGCAGCTTGCCATGTACACCGTGACT
GTCATTGTTGGCTTACTCATTCACGCAGTCATCGTCTTGCCACTCCTCTACTTCTTGGTA
ACACGGAAAAACCCTTGGGTTTTTATTGGAGGGTTGCTGCAAGCACTCATCACCGCTCTG
GGGACCTCTTCAAGTTCTGCCACCCTACCCATCACCTTCAAGTGCCTGGAAGAGAACAAT
GGCGTGGACAAGCGCGTCACCAGATTCGTGCTCCCCGTAGGAGCCACCATTAACATGGAT
GGGACTGCCCTCTATGAGGCTTTGGCTGCCATTTTCATTGCTCAAGTTAACAACTTTGAA
CTGAACTTCGGACAAATTATTACAATCAGCATCACAGCCACAGCTGCCAGTATTGGGGCA
GCTGGAATTCCTCAGGCGGGCCTGGTCACTATGGTCATTGTGCTGACATCTGTCGGCCTG
CCCACTGACGACATCACGCTCATCATCGCGGTGGACTGGTTCCTGGATCGCCTCCGGACC
ACCACCAACGTACTGGGAGACTCCCTGGGAGCTGGGATTGTGGAGCACTTGTCACGACAT
GAACTGAAGAACAGAGATGTTGAAATGGGTAACTCAGTGATTGAAGAGAATGAAATGAAG
AAACCATATCAACTGATTGCACAGGACAATGAAACTGAGAAACCCATCGACAGTGAAACC
AAGATGTAG
Protein Properties
Number of Residues 542
Molecular Weight 59571.9
Theoretical pI 8.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 48-68
  • 91-111
  • 123-145
  • 238-260
  • 281-302
  • 319-340
Protein Sequence
>Excitatory amino acid transporter 1
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIV
GTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPP
NLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSET
KM
GenBank ID Protein 189065391
UniProtKB/Swiss-Prot ID P43003
UniProtKB/Swiss-Prot Entry Name EAA1_HUMAN
PDB IDs Not Available
GenBank Gene ID AK312304
GeneCard ID SLC1A3
GenAtlas ID SLC1A3
HGNC ID HGNC:10941
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Arriza JL, Fairman WA, Wadiche JI, Murdoch GH, Kavanaugh MP, Amara SG: Functional comparisons of three glutamate transporter subtypes cloned from human motor cortex. J Neurosci. 1994 Sep;14(9):5559-69. [PubMed:7521911 ]
  4. Shashidharan P, Plaitakis A: Cloning and characterization of a glutamate transporter cDNA from human cerebellum. Biochim Biophys Acta. 1993 Oct 19;1216(1):161-4. [PubMed:8218410 ]
  5. Kawakami H, Tanaka K, Nakayama T, Inoue K, Nakamura S: Cloning and expression of a human glutamate transporter. Biochem Biophys Res Commun. 1994 Feb 28;199(1):171-6. [PubMed:8123008 ]
  6. Stoffel W, Sasse J, Duker M, Muller R, Hofmann K, Fink T, Lichter P: Human high affinity, Na(+)-dependent L-glutamate/L-aspartate transporter GLAST-1 (EAAT-1): gene structure and localization to chromosome 5p11-p12. FEBS Lett. 1996 May 20;386(2-3):189-93. [PubMed:8647279 ]
  7. Jen JC, Wan J, Palos TP, Howard BD, Baloh RW: Mutation in the glutamate transporter EAAT1 causes episodic ataxia, hemiplegia, and seizures. Neurology. 2005 Aug 23;65(4):529-34. [PubMed:16116111 ]