Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03141
Secondary Accession Numbers
  • 8691
Name Sodium/potassium/calcium exchanger 3
Synonyms
  1. Na(+)/K(+)/Ca(2+)-exchange protein 3
  2. Solute carrier family 24 member 3
Gene Name SLC24A3
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 20p13
SNPs SLC24A3
Gene Sequence
>1935 bp
ATGCGGCCGTCCGGCGACGAGGACCGCGCGCGTCGCCGCCGCCGCCGCCGCCGCCGGAGG
GACCTTCTGCTGAGCCAGCTCTGCTTCCTGGCCTCGGTGGCGCTGCTGCTCTGGTCGCTG
TCGAGCCTGCGAGAGCAGAAGGAGCTTGACCTCATGGACCTCGTAGGGGAAGACAGAAAG
TGGATGATGGCGAGGAAGCTGATGCAGGTGAACGACACTCTGACTTCCGAAGATGCCGGA
CTCCGGAACAGCAAGAACTGCACCGAACCAGCCCTGCATGAATTCCCCAATGACATCTTC
ACAAACGAGGATAGAAGACAAGGTGCGGTGGTCCTCCATGTGCTCTGTGCCATATACATG
TTCTATGCGCTGGCCATTGTGTGTGATGACTTCTTCGTCCCTTCCTTGGAAAAGATCTGT
GAGCGCCTGCACCTCAGTGAAGATGTGGCTGGGGCCACATTCATGGCAGCGGGAAGTTCG
GCCCCAGAGCTGTTCACATCGGTCATAGGGGTCTTCATCACCAAAGGCGATGTGGGAGTT
GGCACCATCGTGGGCTCAGCGGTATTCAACATCCTGTGCATCATTGGTGTCTGTGGGCTC
TTTGCTGGGCAGGTTGTGGCTCTTTCCTCCTGGTGCCTGCTGAGGGATTCTATTTACTAC
ACGCTGTCTGTGATCGCGCTCATCGTGTTTATTTATGATGAAAAAGTTTCCTGGTGGGAG
TCTTTAGTCCTTGTGCTGATGTATCTTATCTACATTGTCATCATGAAATATAACGCTTGC
ATACATCAGTGCTTTGAGAGGAGGACAAAAGGTGCCGGGAACATGGTCAACGGATTGGCC
AACAATGCTGAAATTGATGACAGCAGCAACTGCGACGCAACTGTGGTGCTACTTAAGAAA
GCAAATTTCCACCGCAAAGCATCAGTGATCATGGTAGACGAGCTGCTGTCAGCCTACCCA
CACCAGCTTTCCTTCTCTGAGGCTGGCCTTCGAATCATGATAACCAGCCACTTTCCCCCC
AAGACCCGGCTCTCCATGGCCAGTCGCATGTTGATCAATGAGAGACAAAGATTGATAAAC
AGCAGGGCTTATACCAACGGGGAATCTGAGGTGGCCATCAAAATCCCAATTAAGCACACC
GTGGAGAATGGGACAGGGCCCAGCAGTGCCCCAGACAGGGGCGTGAATGGGACACGGAGG
GACGATGTTGTGGCTGAGGCTGGCAACGAAACAGAGAATGAAAATGAGGACAATGAGAAT
GATGAGGAGGAAGAGGAGGACGAGGATGATGATGAAGGACCGTACACACCATTCGACACC
CCCTCGGGTAAACTGGAAACAGTGAAATGGGCGTTCACCTGGCCGCTGAGTTTCGTCTTA
TACTTCACTGTACCCAACTGCAACAAGCCGCGCTGGGAGAAATGGTTCATGGTGACGTTT
GCTTCCTCCACGCTGTGGATCGCAGCCTTCTCCTACATGATGGTGTGGATGGTCACAATC
ATTGGTTACACCCTGGGGATTCCTGACGTCATCATGGGGATCACCTTCCTGGCTGCTGGG
ACCAGCGTGCCTGACTGCATGGCCAGCCTCATTGTGGCCAGACAAGGGATGGGGGACATG
GCTGTGTCCAACTCCATTGGGAGCAACGTGTTTGACATCCTGATTGGCCTCGGTCTCCCC
TGGGCTCTGCAGACCCTGGCTGTGGATTACGGATCCTACATCCGGCTGAATAGCAGGGGG
CTGATCTACTCCGTAGGCTTGCTCCTGGCCTCTGTTTTTGTCACGGTGTTCGGCGTCCAC
CTGAACAAGTGGCAGCTGGACAAGAAGCTGGGCTGTGGGTGCCTCCTCCTGTATGGTGTG
TTCCTGTGCTTCTCCATCATGACTGAGTTCAACGTGTTCACCTTTGTGAACCTGCCCATG
TGCGGGGACCACTGA
Protein Properties
Number of Residues 644
Molecular Weight 71991.4
Theoretical pI 4.98
Pfam Domain Function
Signals
  • 1-44
Transmembrane Regions
  • 108-128
  • 154-174
  • 183-203
  • 211-231
  • 235-255
  • 485-505
  • 511-531
  • 550-570
  • 581-601
  • 616-636
Protein Sequence
>Sodium/potassium/calcium exchanger 3
MRPSGDEDRARRRRRRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLVGEDRK
WMMARKLMQVNDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYM
FYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGV
GTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALIVFIYDEKVSWWE
SLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKK
ANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLIN
SRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNEN
DEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTF
ASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDM
AVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVH
LNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMCGDH
GenBank ID Protein 31563526
UniProtKB/Swiss-Prot ID Q9HC58
UniProtKB/Swiss-Prot Entry Name NCKX3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020689.3
GeneCard ID SLC24A3
GenAtlas ID SLC24A3
HGNC ID HGNC:10977
References
General References
  1. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  2. Kraev A, Quednau BD, Leach S, Li XF, Dong H, Winkfein R, Perizzolo M, Cai X, Yang R, Philipson KD, Lytton J: Molecular cloning of a third member of the potassium-dependent sodium-calcium exchanger gene family, NCKX3. J Biol Chem. 2001 Jun 22;276(25):23161-72. Epub 2001 Apr 9. [PubMed:11294880 ]