You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03147
Secondary Accession Numbers
  • 8698
Name Excitatory amino acid transporter 2
Synonyms
  1. Glutamate/aspartate transporter II
  2. Sodium-dependent glutamate/aspartate transporter 2
  3. Solute carrier family 1 member 2
Gene Name SLC1A2
Protein Type Unknown
Biological Properties
General Function Involved in sodium:dicarboxylate symporter activity
Specific Function Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
organic acid transmembrane transporter activity
carboxylic acid transmembrane transporter activity
dicarboxylic acid transmembrane transporter activity
sodium:dicarboxylate symporter activity
Process
establishment of localization
transport
organic acid transport
carboxylic acid transport
dicarboxylic acid transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11p13-p12
SNPs SLC1A2
Gene Sequence
>1725 bp
ATGGCATCTACGGAAGGTGCCAACAATATGCCCAAGCAGGTGGAAGTGCGAATGCACGAC
AGTCATCTTGGCTCAGAGGAACCCAAGCACCGGCACCTGGGCCTGCGCCTGTGTGACAAG
CTGGGGAAGAATCTGCTGCTCACCCTGACGGTGTTTGGTGTCATCCTGGGAGCAGTGTGT
GGAGGGCTTCTTCGCTTGGCATCTCCCATCCACCCTGATGTGGTTATGTTAATAGCCTTC
CCAGGGGATATACTCATGAGGATGCTAAAAATGCTCATTCTCCCTCTAATCATCTCCAGC
TTAATCACAGGGTTGTCAGGCCTGGATGCTAAGGCTAGTGGCCGCTTGGGCACGAGAGCC
ATGGTGTATTACATGTCCACGACCATCATTGCTGCAGTACTGGGGGTCATTCTGGTCTTG
GCTATCCATCCAGGCAATCCCAAGCTCAAGAAGCAGCTGGGGCCTGGGAAGAAGAATGAT
GAAGTGTCCAGCCTGGATGCCTTCCTGGACCTTATTCGAAATCTCTTCCCTGAAAACCTT
GTCCAAGCCTGCTTTCAACAGATTCAAACAGTGACGAAGAAAGTCCTGGTTGCACCACCG
CCGGACGAGGAGGCCAACGCAACCAGCGCTGTTGTCTCTCTGTTGAACGAGACTGTGACT
GAGGTGCCGGAGGAGACTAAGATGGTTATCAAGAAGGGCCTGGAGTTCAAGGATGGGATG
AACGTCTTAGGTCTGATAGGGTTTTTCATTGCTTTTGGCATCGCTATGGGGAAGATGGGA
GATCAGGCCAAGCTGATGGTGGATTTCTTCAACATTTTGAATGAGATTGTAATGAAGTTA
GTGATCATGATCATGTGGTACTCTCCCCTGGGTATCGCCTGCCTGATCTGTGGAAAGATC
ATTGCAATCAAGGACTTAGAAGTGGTTGCTAGGCAACTGGGGATGTACATGGTAACAGTG
ATCATAGGCCTCATCATCCACGGGGGCATCTTTCTCCCCTTGATTTACTTTGTAGTGACC
AGGAAAAACCCCTTCTCCTTTTTTGCTGGCATTTTCCAAGCTTGGATCACTGCCCTGGGC
ACCGCTTCCAGTGCTGGAACTTTGCCTGTCACCTTTCGTTGCCTGGAAGAAAATCTGGGG
ATTGATAAGCGTGTGACTAGATTCGTCCTTCCTGTTGGAGCAACCATTAACATGGATGGT
ACAGCCCTTTATGAAGCGGTAGCCGCCATCTTTATAGCCCAAATGAATGGTGTTGTCCTG
GATGGAGGACAGATTGTGACTGTAAGCCTCACAGCCACCCTGGCAAGCGTCGGCGCGGCC
AGTATCCCCAGTGCCGGGCTGGTCACCATGCTCCTCATTCTGACAGCCGTGGGCCTGCCA
ACAGAGGACATCAGCCTGCTGGTGGCTGTGGACTGGCTGCTGGACAGGATGAGAACTTCA
GTCAATGTTGTGGGTGACTCTTTTGGGGCTGGGATAGTCTATCACCTCTCCAAGTCTGAG
CTGGATACCATTGACTCCCAGCATCGAGTGCATGAAGATATTGAAATGACCAAGACTCAA
TCCATTTATGATGACATGAAGAACCACAGGGAAAGCAACTCTAATCAATGTGTCTATGCT
GCACACAACTCTGTCATAGTAGATGAATGCAAGGTAACTCTGGCAGCCAATGGAAAGTCA
GCCGACTGCAGTGTTGAGGAAGAACCTTGGAAACGTGAGAAATAA
Protein Properties
Number of Residues 574
Molecular Weight 62103.7
Theoretical pI 6.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 45-64
  • 88-108
  • 121-142
  • 240-259
  • 280-301
  • 317-339
  • 406-430
  • 437-459
Protein Sequence
>Excitatory amino acid transporter 2
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
GenBank ID Protein 40254478
UniProtKB/Swiss-Prot ID P43004
UniProtKB/Swiss-Prot Entry Name EAA2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004171
GeneCard ID SLC1A2
GenAtlas ID SLC1A2
HGNC ID HGNC:10940
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. DeGiorgis JA, Jaffe H, Moreira JE, Carlotti CG Jr, Leite JP, Pant HC, Dosemeci A: Phosphoproteomic analysis of synaptosomes from human cerebral cortex. J Proteome Res. 2005 Mar-Apr;4(2):306-15. [PubMed:15822905 ]
  4. Arriza JL, Fairman WA, Wadiche JI, Murdoch GH, Kavanaugh MP, Amara SG: Functional comparisons of three glutamate transporter subtypes cloned from human motor cortex. J Neurosci. 1994 Sep;14(9):5559-69. [PubMed:7521911 ]
  5. Shashidharan P, Wittenberg I, Plaitakis A: Molecular cloning of human brain glutamate/aspartate transporter II. Biochim Biophys Acta. 1994 May 11;1191(2):393-6. [PubMed:8172925 ]
  6. Manfras BJ, Rudert WA, Trucco M, Boehm BO: Cloning and characterization of a glutamate transporter cDNA from human brain and pancreas. Biochim Biophys Acta. 1994 Oct 12;1195(1):185-8. [PubMed:7522567 ]
  7. Shimamoto K, Lebrun B, Yasuda-Kamatani Y, Sakaitani M, Shigeri Y, Yumoto N, Nakajima T: DL-threo-beta-benzyloxyaspartate, a potent blocker of excitatory amino acid transporters. Mol Pharmacol. 1998 Feb;53(2):195-201. [PubMed:9463476 ]
  8. Kim SY, Chao W, Choi SY, Volsky DJ: Cloning and characterization of the 3'-untranslated region of the human excitatory amino acid transporter 2 transcript. J Neurochem. 2003 Sep;86(6):1458-67. [PubMed:12950454 ]
  9. Gendreau S, Voswinkel S, Torres-Salazar D, Lang N, Heidtmann H, Detro-Dassen S, Schmalzing G, Hidalgo P, Fahlke C: A trimeric quaternary structure is conserved in bacterial and human glutamate transporters. J Biol Chem. 2004 Sep 17;279(38):39505-12. Epub 2004 Jul 20. [PubMed:15265858 ]