You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03165
Secondary Accession Numbers
  • 8721
Name Dihydropyrimidinase-related protein 2
Synonyms
  1. CRMP-2
  2. Collapsin response mediator protein 2
  3. DRP-2
  4. N2A3
  5. ULIP-2
  6. Unc-33-like phosphoprotein 2
Gene Name DPYSL2
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:8
Locus 8p22-p21
SNPs DPYSL2
Gene Sequence
>1719 bp
ATGTCTTATCAGGGGAAGAAAAATATTCCACGCATCACGAGCGATCGTCTTCTGATCAAA
GGAGGTAAAATTGTTAATGATGACCAGTCGTTCTATGCAGACATATACATGGAAGATGGG
TTGATCAAGCAAATAGGAGAAAATCTGATTGTGCCAGGAGGAGTGAAGACCATCGAGGCC
CACTCCCGGATGGTGATCCCCGGAGGAATTGACGTCCACACTCGTTTCCAGATGCCTGAT
CAGGGAATGACGTCTGCTGATGATTTCTTCCAAGGAACCAAGGCGGCCCTGGCTGGGGGA
ACCACTATGATCATTGACCACGTTGTTCCTGAGCCTGGGACAAGCCTGCTCGCTGCCTTT
GACCAGTGGAGGGAATGGGCCGACAGCAAGTCCTGCTGTGACTACTCTCTGCATGTGGAC
ATCAGCGAGTGGCATAAGGGCATCCAGGAGGAGATGGAAGCGCTTGTGAAGGATCACGGG
GTAAATTCCTTCCTCGTGTACATGGCTTTCAAAGATCGCTTCCAGCTAACGGATTGCCAG
ATTTATGAAGTACTGAGTGTGATCCGGGATATTGGCGCCATAGCCCAAGTCCACGCAGAA
AATGGCGACATCATTGCAGAGGAGCAGCAGAGGATCCTGGATCTGGGCATCACGGGCCCC
GAGGGACATGTGCTGAGCCGACCTGAGGAGGTCGAGGCCGAAGCCGTGAATCGTGCCATC
ACCATCGCCAACCAGACCAACTGCCCGCTGTATATCACCAAGGTGATGAGCAAAAGCTCT
GCTGAGGTCATCGCCCAGGCACGGAAGAAGGGAACTGTGGTGTATGGCGAGCCCATCACT
GCCAGCTTGGGAACGGACGGCTCCCATTACTGGAGCAAGAACTGGGCCAAGGCTGCTGCC
TTTGTCACCTCCCCACCCTTGAGCCCTGATCCAACCACTCCAGACTTTCTCAACTCCTTG
CTGTCCTGTGGAGACCTCCAGGTCACGGGCAGTGCCCATTGCACGTTTAACACTGCCCAG
AAGGCTGTAGGAAAGGACAACTTCACCCTGATTCCGGAGGGCACCAATGGCACTGAGGAG
CGGATGTCCGTCATCTGGGACAAGGCTGTGGTCACTGGGAAGATGGATGAGAACCAGTTT
GTGGCTGTGACCAGCACCAATGCAGCCAAAGTCTTCAACCTTTACCCCCGGAAAGGCCGC
ATTGCTGTGGGATCCGATGCCGACCTGGTCATCTGGGACCCCGACAGCGTTAAAACCATC
TCTGCCAAGACACACAACAGCTCTCTCGAGTACAACATCTTTGAAGGCATGGAGTGCCGC
GGCTCCCCACTGGTGGTCATCAGCCAGGGGAAGATTGTCCTGGAGGACGGCACCCTGCAT
GTCACCGAAGGCTCTGGACGCTACATTCCCCGGAAGCCCTTCCCTGATTTTGTTTACAAG
CGTATCAAGGCAAGGAGCAGGCTGGCTGAGCTGAGAGGGGTTCCTCGTGGCCTGTATGAC
GGACCTGTGTGTGAAGTGTCTGTGACGCCCAAGACAGTCACTCCAGCCTCCTCGGCCAAG
ACGTCTCCTGCCAAGCAGCAGGCCCCACCTGTCCGGAACCTGCACCAGTCTGGATTCAGT
TTGTCTGGTGCTCAGATTGATGACAACATTCCCCGCCGCACCACCCAGCGTATCGTGGCG
CCCCCCGGTGGCCGTGCCAACATCACCAGCCTGGGCTAG
Protein Properties
Number of Residues 572
Molecular Weight 62293.1
Theoretical pI 6.33
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dihydropyrimidinase-related protein 2
MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEA
HSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAF
DQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQ
IYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAI
TIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA
FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEE
RMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYK
RIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFS
LSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
GenBank ID Protein 6467213
UniProtKB/Swiss-Prot ID Q16555
UniProtKB/Swiss-Prot Entry Name DPYL2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB020777
GeneCard ID DPYSL2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  8. Hamajima N, Matsuda K, Sakata S, Tamaki N, Sasaki M, Nonaka M: A novel gene family defined by human dihydropyrimidinase and three related proteins with differential tissue distribution. Gene. 1996 Nov 21;180(1-2):157-63. [PubMed:8973361 ]
  9. Goshima Y, Nakamura F, Strittmatter P, Strittmatter SM: Collapsin-induced growth cone collapse mediated by an intracellular protein related to UNC-33. Nature. 1995 Aug 10;376(6540):509-14. [PubMed:7637782 ]
  10. Kitamura K, Takayama M, Hamajima N, Nakanishi M, Sasaki M, Endo Y, Takemoto T, Kimura H, Iwaki M, Nonaka M: Characterization of the human dihydropyrimidinase-related protein 2 (DRP-2) gene. DNA Res. 1999 Oct 29;6(5):291-7. [PubMed:10574455 ]
  11. Gu Y, Hamajima N, Ihara Y: Neurofibrillary tangle-associated collapsin response mediator protein-2 (CRMP-2) is highly phosphorylated on Thr-509, Ser-518, and Ser-522. Biochemistry. 2000 Apr 18;39(15):4267-75. [PubMed:10757975 ]
  12. Inagaki N, Chihara K, Arimura N, Menager C, Kawano Y, Matsuo N, Nishimura T, Amano M, Kaibuchi K: CRMP-2 induces axons in cultured hippocampal neurons. Nat Neurosci. 2001 Aug;4(8):781-2. [PubMed:11477421 ]
  13. Kawano Y, Yoshimura T, Tsuboi D, Kawabata S, Kaneko-Kawano T, Shirataki H, Takenawa T, Kaibuchi K: CRMP-2 is involved in kinesin-1-dependent transport of the Sra-1/WAVE1 complex and axon formation. Mol Cell Biol. 2005 Nov;25(22):9920-35. [PubMed:16260607 ]
  14. Deo RC, Schmidt EF, Elhabazi A, Togashi H, Burley SK, Strittmatter SM: Structural bases for CRMP function in plexin-dependent semaphorin3A signaling. EMBO J. 2004 Jan 14;23(1):9-22. Epub 2003 Dec 18. [PubMed:14685275 ]
  15. Stenmark P, Ogg D, Flodin S, Flores A, Kotenyova T, Nyman T, Nordlund P, Kursula P: The structure of human collapsin response mediator protein 2, a regulator of axonal growth. J Neurochem. 2007 May;101(4):906-17. Epub 2007 Jan 22. [PubMed:17250651 ]