You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03171
Secondary Accession Numbers
  • 8729
Name Sodium/calcium exchanger 2
Synonyms
  1. Na(+)/Ca(2+)-exchange protein 2
Gene Name SLC8A2
Protein Type Unknown
Biological Properties
General Function Involved in cell communication
Specific Function Rapidly transports Ca(2+) during excitation-contraction coupling. Ca(2+) is extruded from the cell during relaxation so as to prevent overloading of intracellular stores
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
solute:cation antiporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
cation:cation antiporter activity
calcium:cation antiporter activity
calcium:sodium antiporter activity
transporter activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
cellular process
transport
transmembrane transport
ion transport
cation transport
cell communication
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.3
SNPs SLC8A2
Gene Sequence
>2766 bp
ATGGCTCCCCTGGCCTTGGTGGGGGTCACACTCCTCCTGGCGGCTCCCCCATGCTCCGGG
GCAGCCACCCCAACCCCCTCCCTGCCGCCTCCCCCGGCCAATGACAGCGACACCAGCACA
GGGGGCTGCCAGGGGTCCTACCGCTGCCAGCCGGGGGTGCTGCTGCCCGTGTGGGAGCCC
GACGACCCGTCGCTGGGTGACAAGGCGGCACGGGCAGTGGTGTACTTTGTGGCCATGGTC
TACATGTTTCTGGGAGTGTCCATCATCGCCGACCGTTTCATGGCGGCCATCGAGGTCATC
ACGTCAAAAGAGAAGGAGATCACCATCACCAAGGCCAACGGTGAGACCAGCGTGGGCACC
GTTCGCATCTGGAATGAGACGGTGTCCAACCTCACGCTCATGGCCCTGGGCTCCTCCGCA
CCTGAGATCCTGCTGTCAGTCATCGAAGTCTGCGGCCACAACTTCCAGGCGGGTGAGCTG
GGCCCAGGCACCATCGTGGGCAGCGCTGCCTTCAACATGTTTGTGGTCATCGCCGTGTGC
ATCTACGTCATCCCAGCCGGCGAGAGCCGCAAGATCAAGCACCTGAGAGTCTTCTTTGTC
ACTGCCTCTTGGAGCATCTTCGCCTATGTCTGGCTTTATCTCATCCTTGCTGTTTTTTCC
CCCGGTGTGGTCCAGGTGTGGGAGGCGCTGCTGACCCTGGTCTTCTTCCCGGTGTGCGTG
GTATTCGCCTGGATGGCCGACAAGCGGCTGCTCTTCTACAAGTACGTGTACAAGCGCTAC
CGCACCGACCCACGCAGCGGCATCATCATAGGCGCCGAGGGCGACCCCCCGAAGAGCATC
GAGCTGGACGGCACGTTCGTGGGCGCCGAGGCCCCAGGTGAGCTGGGCGGCCTGGGCCCG
GGCCCCGCCGAGGCGCGCGAGCTGGACGCCAGCCGCCGCGAGGTCATCCAGATCCTCAAG
GACCTCAAGCAGAAGCACCCGGACAAGGATCTGGAGCAGCTGGTGGGCATCGCCAACTAC
TACGCGCTGCTGCACCAGCAGAAGAGCCGCGCCTTCTACCGCATCCAGGCCACGCGGCTG
ATGACCGGCGCCGGGAACGTGCTGCGCAGACACGCGGCGGACGCCTCGCGCAGGGCGGCG
CCGGCCGAGGGCGCGGGCGAGGACGAAGACGACGGCGCCAGCCGCATCTTCTTCGAGCCT
AGCCTCTACCACTGCCTGGAGAACTGCGGCTCCGTGCTGCTGTCCGTCACGTGCCAGGGC
GGCGAGGGCAACAGCACCTTCTACGTGGACTACCGCACTGAGGACGGCTCTGCCAAGGCG
GGCTCCGACTACGAGTACAGCGAGGGCACGCTGGTGTTCAAACCAGGCGAGACGCAGAAG
GAGCTGCGCATCGGCATCATCGACGACGACATCTTCGAGGAGGACGAGCATTTCTTCGTG
CGGCTGCTGAACCTGCGCGTGGGCGACGCGCAGGGCATGTTCGAGCCGGACGGCGGCGGG
CGGCCCAAGGGGCGGCTGGTGGCGCCGCTGCTGGCCACCGTCACCATCCTGGACGACGAC
CACGCAGGCATCTTCTCCTTCCAGGACCGCCTGCTGCACGTGAGCGAGTGCATGGGCACC
GTGGACGTGCGCGTCGTGCGCAGCTCGGGCGCGCGCGGCACCGTGCGCCTTCCCTACCGC
ACGGTGGACGGCACGGCGCGCGGCGGCGGCGTGCACTACGAGGACGCGTGCGGAGAGCTG
GAGTTTGGCGACGACGAGACCATGAAAACTCTTCAGGTGAAGATAGTTGATGACGAGGAA
TATGAGAAAAAGGATAATTTCTTCATTGAGCTGGGCCAGCCCCAGTGGCTTAAGCGAGGG
ATTTCAGCTCTGCTACTCAATCAAGGGGATGGGGACAGGAAGCTAACAGCCGAGGAGGAG
GAGGCTCGGAGGATAGCAGAGATGGGCAAGCCAGTTCTTGGGGAGAACTGCCGGCTGGAG
GTCATCATCGAGGAGTCATATGATTTTAAGAACACGGTGGATAAACTCATCAAGAAAACG
AACTTGGCCTTGGTAATTGGGACCCATTCATGGAGGGAGCAGTTTTTAGAGGCAATTACG
GTGAGCGCAGGGGACGAGGAGGAGGAGGAGGACGGGTCCCGGGAGGAGCGGCTGCCGTCG
TGCTTTGACTACGTGATGCACTTCCTGACGGTGTTCTGGAAGGTGCTCTTCGCCTGTGTG
CCCCCCACCGAGTACTGCCACGGCTGGGCCTGCTTTGGTGTCTCCATCCTGGTCATCGGC
CTGCTCACCGCCCTCATTGGGGACCTCGCCTCCCACTTCGGCTGCACCGTTGGCCTCAAG
GACTCTGTCAATGCTGTTGTCTTCGTTGCCCTGGGCACCTCCATCCCTGACACGTTCGCC
AGCAAGGTGGCGGCGCTGCAGGACCAGTGCGCCGACGCGTCCATCGGCAACGTGACCGGC
TCCAACGCGGTGAACGTGTTCCTTGGCCTGGGCGTCGCCTGGTCTGTGGCCGCCGTGTAC
TGGGCGGTGCAGGGCCGCCCCTTCGAGGTGCGCACTGGCACGCTGGCCTTCTCCGTCACG
CTCTTCACCGTCTTCGCCTTCGTGGGCATTGCCGTGCTGCTGTACCGGCGCCGGCCGCAC
ATCGGCGGCGAGCTGGGCGGCCCGCGCGGACCCAAGCTCGCCACCACCGCGCTCTTCCTG
GGCCTCTGGCTCCTGTACATCCTCTTCGCCAGCCTGGAGGCGTACTGCCACATCCGGGGC
TTCTAG
Protein Properties
Number of Residues 921
Molecular Weight 100366.9
Theoretical pI 4.78
Pfam Domain Function
Signals
  • 1-20
Transmembrane Regions
  • 69-90
  • 131-152
  • 165-185
  • 197-219
  • 223-246
  • 721-740
  • 748-770
  • 773-791
  • 823-843
  • 855-875
  • 893-909
Protein Sequence
>Sodium/calcium exchanger 2
MAPLALVGVTLLLAAPPCSGAATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEP
DDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
IYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGELGGLGP
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEARRIAEMGKPVLGENCRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEEDGSREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFL
GLWLLYILFASLEAYCHIRGF
GenBank ID Protein 57163987
UniProtKB/Swiss-Prot ID Q9UPR5
UniProtKB/Swiss-Prot Entry Name NAC2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015063.2
GeneCard ID SLC8A2
GenAtlas ID SLC8A2
HGNC ID HGNC:11069
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. [PubMed:10470851 ]