You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03183
Secondary Accession Numbers
  • 8742
Name Inositol-trisphosphate 3-kinase C
Synonyms
  1. IP3 3-kinase C
  2. IP3K C
  3. Inositol 1,4,5-trisphosphate 3-kinase C
  4. InsP 3-kinase C
Gene Name ITPKC
Protein Type Unknown
Biological Properties
General Function Involved in inositol trisphosphate 3-kinase activity
Specific Function Can phosphorylate inositol 2,4,5-triphosphate to inositol 2,4,5,6-tetraphosphate (By similarity).
Pathways
  • Calcium signaling pathway
  • Inositol phosphate metabolism
  • Phosphatidylinositol signaling system
Reactions
Adenosine triphosphate + myo-Inositol 1,4,5-trisphosphate → ADP + myo-Inositol 1,3,4,5-tetrakisphosphate details
GO Classification
Cellular Component
cytoplasm
nucleus
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
inositol or phosphatidylinositol kinase activity
inositol trisphosphate kinase activity
inositol trisphosphate 3-kinase activity
Molecular Function
ATP binding
inositol-1,4,5-trisphosphate 3-kinase activity
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 19
Locus 19q13.1
SNPs ITPKC
Gene Sequence
>2052 bp
ATGAGGCGCTGCCCGTGCCGTGGGAGCCTGAACGAGGCGGAGGCCGGGGCGCTGCCCGCG
GCGGCCCGCATGGGACTGGAGGCGCCGCGAGGAGGGCGGCGGCGGCAGCCGGGACAGCAG
CGACCTGGGCCCGGCGCAGGGGCCCCGGCGGGGCGGCCGGAGGGGGGCGGGCCCTGGGCC
CGGACAGAGGGGTCCAGCCTCCACAGCGAGCCTGAGAGGGCCGGCCTCGGGCCTGCGCCG
GGGACAGAGAGTCCGCAGGCAGAATTCTGGACAGACGGACAGACTGAGCCCGCGGCAGCT
GGCCTTGGAGTAGAGACCGAGAGGCCCAAGCAAAAGACGGAGCCAGACAGGTCCAGCCTC
CGGACGCATCTAGAATGGAGCTGGTCAGAGCTGGAGACGACTTGTCTTTGGACGGAGACC
GGGACAGATGGCCTTTGGACTGATCCGCACAGGTCCGACCTCCAGTTTCAGCCCGAGGAG
GCCAGCCCCTGGACACAGCCAGGGGTTCATGGGCCCTGGACAGAGCTGGAAACGCATGGG
TCACAGACTCAGCCAGAGAGGGTCAAGTCCTGGGCTGATAACCTCTGGACCCACCAGAAC
AGTTCCAGCCTCCAGACTCACCCAGAAGGAGCCTGTCCCTCAAAAGAGCCAAGTGCTGAT
GGCTCCTGGAAAGAATTGTATACTGATGGCTCCAGGACACAACAGGATATTGAAGGTCCC
TGGACAGAGCCATATACTGATGGCTCCCAGAAAAAACAGGATACTGAAGCAGCCAGGAAA
CAGCCTGGCACTGGTGGTTTCCAAATACAACAGGATACTGATGGCTCCTGGACACAACCT
AGCACTGACGGTTCCCAGACAGCACCTGGGACAGACTGCCTCTTGGGAGAGCCTGAGGAT
GGCCCATTAGAGGAACCAGAGCCTGGAGAATTGCTGACTCACCTGTACTCTCACCTGAAG
TGTAGCCCCCTGTGCCCTGTGCCCCGCCTCATCATTACCCCTGAGACCCCTGAGCCTGAG
GCCCAGCCAGTGGGACCCCCCTCCCGGGTTGAGGGGGGCAGCGGCGGCTTCTCCTCTGCC
TCTTCTTTCGACGAGTCTGAGGATGACGTGGTGGCCGGGGGCGGAGGTGCCAGCGATCCC
GAGGACAGGTCTGGGAGCAAACCCTGGAAGAAGCTGAAGACAGTTCTGAAGTATTCACCC
TTTGTGGTCTCCTTCCGAAAACACTACCCTTGGGTCCAGCTTTCTGGACATGCTGGGAAC
TTCCAGGCAGGAGAGGATGGTCGGATTCTGAAACGTTTCTGTCAGTGTGAGCAGCGCAGC
CTGGAGCAGCTGATGAAAGACCCGCTGCGACCTTTCGTGCCTGCCTACTATGGCATGGTG
CTGCAGGATGGCCAGACCTTCAACCAGATGGAAGACCTCCTGGCTGACTTTGAGGGCCCC
TCCATTATGGACTGCAAGATGGGCAGCAGGACCTATCTGGAAGAGGAGCTAGTGAAGGCA
CGGGAACGTCCCCGTCCCCGGAAGGACATGTATGAGAAGATGGTGGCTGTGGACCCTGGG
GCCCCTACCCCTGAGGAGCATGCCCAGGGTGCAGTCACCAAGCCCCGCTACATGCAGTGG
AGGGAAACCATGAGCTCCACCTCTACCCTGGGCTTCCGGATCGAGGGCATCAAGAAGGCA
GATGGGACCTGTAACACCAACTTCAAGAAGACGCAGGCACTGGAGCAGGTGACAAAAGTG
CTGGAGGACTTCGTGGATGGAGACCACGTCATCCTGCAAAAGTACGTGGCATGCCTAGAA
GAACTTCGTGAAGCTCTGGAGATCTCCCCCTTCTTCAAGACCCACGAGGTGGTAGGCAGC
TCCCTCCTCTTCGTGCACGACCACACCGGCCTGGCCAAGGTCTGGATGATAGACTTCGGC
AAGACGGTGGCCTTGCCCGACCACCAGACGCTCAGCCACAGGCTGCCCTGGGCTGAGGGC
AACCGTGAGGACGGCTACCTCTGGGGCCTGGACAACATGATCTGCCTCCTGCAGGGGCTG
GCACAGAGCTGA
Protein Properties
Number of Residues 683
Molecular Weight 75207.0
Theoretical pI 5.139
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Inositol-trisphosphate 3-kinase C
MRRCPCRGSLNEAEAGALPAAARMGLEAPRGGRRRQPGQQRPGPGAGAPAGRPEGGGPWA
RTEGSSLHSEPERAGLGPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQKTEPDRSSL
RTHLEWSWSELETTCLWTETGTDGLWTDPHRSDLQFQPEEASPWTQPGVHGPWTELETHG
SQTQPERVKSWADNLWTHQNSSSLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGP
WTEPYTDGSQKKQDTEAARKQPGTGGFQIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPED
GPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSA
SSFDESEDDVVAGGGGASDPEDRSGSKPWKKLKTVLKYSPFVVSFRKHYPWVQLSGHAGN
FQAGEDGRILKRFCQCEQRSLEQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGP
SIMDCKMGSRTYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQW
RETMSSTSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVDGDHVILQKYVACLE
ELREALEISPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPWAEG
NREDGYLWGLDNMICLLQGLAQS
GenBank ID Protein 14330286
UniProtKB/Swiss-Prot ID Q96DU7
UniProtKB/Swiss-Prot Entry Name IP3KC_HUMAN
PDB IDs
GenBank Gene ID AJ290975
GeneCard ID ITPKC
GenAtlas ID ITPKC
HGNC ID HGNC:14897
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Kornak U, Reynders E, Dimopoulou A, van Reeuwijk J, Fischer B, Rajab A, Budde B, Nurnberg P, Foulquier F, Lefeber D, Urban Z, Gruenewald S, Annaert W, Brunner HG, van Bokhoven H, Wevers R, Morava E, Matthijs G, Van Maldergem L, Mundlos S: Impaired glycosylation and cutis laxa caused by mutations in the vesicular H+-ATPase subunit ATP6V0A2. Nat Genet. 2008 Jan;40(1):32-4. Epub 2007 Dec 23. [PubMed:18157129 ]
  3. Dewaste V, Pouillon V, Moreau C, Shears S, Takazawa K, Erneux C: Cloning and expression of a cDNA encoding human inositol 1,4,5-trisphosphate 3-kinase C. Biochem J. 2000 Dec 1;352 Pt 2:343-51. [PubMed:11085927 ]
  4. Dewaste V, Moreau C, De Smedt F, Bex F, De Smedt H, Wuytack F, Missiaen L, Erneux C: The three isoenzymes of human inositol-1,4,5-trisphosphate 3-kinase show specific intracellular localization but comparable Ca2+ responses on transfection in COS-7 cells. Biochem J. 2003 Aug 15;374(Pt 1):41-9. [PubMed:12747803 ]