You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03195
Secondary Accession Numbers
  • 8758
Name Equilibrative nucleoside transporter 2
Synonyms
  1. 36 kDa nucleolar protein HNP36
  2. Delayed-early response protein 12
  3. Equilibrative NBMPR-insensitive nucleoside transporter
  4. Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleoside transporter
  5. Hydrophobic nucleolar protein, 36 kDa
  6. Nucleoside transporter, ei-type
  7. Solute carrier family 29 member 2
Gene Name SLC29A2
Protein Type Enzyme
Biological Properties
General Function Involved in nucleoside transmembrane transporter activity
Specific Function Mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. Less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine
Pathways
  • Azathioprine Action Pathway
  • Mercaptopurine Action Pathway
  • Mercaptopurine Metabolism Pathway
  • Thioguanine Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
nucleobase, nucleoside, nucleotide and nucleic acid transmembrane transporter activity
nucleoside transmembrane transporter activity
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Multi-pass membrane protein
  2. Isoform 2:Nucleus membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13
SNPs SLC29A2
Gene Sequence
>1371 bp
ATGGCCCGAGGAGACGCCCCGCGGGACAGCTACCACCTGGTCGGGATCAGCTTCTTCATC
CTGGGGCTGGGCACCCTCCTTCCCTGGAACTTCTTCATCACCGCCATCCCGTACTTCCAG
GCGCGACTGGCCGGGGCCGGCAACAGCACAGCCAGGATCCTGAGCACCAACCACACGGGT
CCCGAGGATGCCTTCAACTTCAACAATTGGGTGACGCTGCTGTCCCAGCTGCCCCTGCTG
CTCTTCACCCTCCTCAACTCCTTCCTGTACCAGTGCGTCCCGGAGACGGTGCGCATTCTG
GGCAGCCTGCTGGCCATACTGCTGCTCTTTGCCCTGACAGCAGCGCTGGTCAAGGTGGAC
ATGAGCCCCGGACCCTTCTTCTCCATCACCATGGCCTCCGTCTGCTTCATCAACTCCTTC
AGTGCAGTCCTACAGGGCAGCCTCTTCGGGCAGCTGGGCACCATGCCCTCCACCTACAGC
ACCCTCTTCCTCAGCGGCCAGGGCCTGGCTGGGATCTTTGCTGCCCTTGCCATGCTCCTG
TCCATGGCCAGTGGCGTGGACGCCGAGACCTCTGCCCTGGGGTACTTTATCACGCCCTAT
GTGGGCATCCTCATGTCCATCGTGTGTTACCTGAGCCTGCCTCACCTGAAGTTTGCCCGC
TACTACCTGGCCAATAAATCATCCCAGGCCCAAGCTCAGGAGCTGGAGACCAAAGCTGAG
CTCCTCCAGTCTGATGAGAACGGGATTCCCAGTAGTCCCCAGAAAGTAGCTCTGACCCTG
GATCTTGACCTGGAGAAGGAGCCGGAATCAGAGCCAGATGAGCCCCAGAAGCCAGGAAAA
CCTTCAGTCTTCACTGTCTTCCAGAAGATCTGGCTGACAGCGCTGTGCCTTGTGTTGGTC
TTCACAGTCACCCTGTCCGTCTTCCCCGCCATCACAGCCATGGTGACCAGCTCCACCAGT
CCTGGGAAGTGGAGTCAGTTCTTCAACCCCATCTGCTGCTTCCTCCTCTTCAACATCATG
GACTGGCTGGGACGGAGCCTGACCTCTTACTTCCTGTGGCCAGACGAGGACAGCCGGCTG
CTGCCCCTGCTGGTCTGCCTGCGGTTCCTGTTCGTGCCCCTCTTCATGCTGTGCCACGTG
CCCCAGAGGTCCCGGCTGCCCATCCTCTTCCCACAGGATGCCTACTTCATCACCTTCATG
CTGCTCTTTGCCGTTTCTAATGGCTACCTGGTGTCCCTCACCATGTGCCTGGCGCCCAGG
CAGGTGCTGCCACACGAGAGGGAGGTGGCCGGCGCCCTCATGACCTTCTTCCTGGCCCTG
GGACTTTCCTGTGGAGCCTCCCTCTCCTTCCTCTTCAAGGCGCTGCTCTGA
Protein Properties
Number of Residues 456
Molecular Weight 50112.3
Theoretical pI 6.02
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 13-33
  • 70-90
  • 99-119
  • 124-144
  • 162-182
  • 193-213
  • 291-311
  • 324-344
  • 360-380
  • 386-406
  • 432-452
Protein Sequence
>Equilibrative nucleoside transporter 2
MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTG
PEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVD
MSPGPFFSITMASVCFINSFSAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLL
SMASGVDAETSALGYFITPCVGILMSIVCYLSLPHLKFARYYLANKSSQAQAQELETKAE
LLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQKIWLTALCLVLV
FTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSYFLWPDEDSRL
LPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL
GenBank ID Protein 2754821
UniProtKB/Swiss-Prot ID Q14542
UniProtKB/Swiss-Prot Entry Name S29A2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF029358
GeneCard ID SLC29A2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Crawford CR, Patel DH, Naeve C, Belt JA: Cloning of the human equilibrative, nitrobenzylmercaptopurine riboside (NBMPR)-insensitive nucleoside transporter ei by functional expression in a transport-deficient cell line. J Biol Chem. 1998 Feb 27;273(9):5288-93. [PubMed:9478986 ]
  5. Griffiths M, Yao SY, Abidi F, Phillips SE, Cass CE, Young JD, Baldwin SA: Molecular cloning and characterization of a nitrobenzylthioinosine-insensitive (ei) equilibrative nucleoside transporter from human placenta. Biochem J. 1997 Dec 15;328 ( Pt 3):739-43. [PubMed:9396714 ]
  6. Williams JB, Lanahan AA: A mammalian delayed-early response gene encodes HNP36, a novel, conserved nucleolar protein. Biochem Biophys Res Commun. 1995 Aug 4;213(1):325-33. [PubMed:7639753 ]
  7. Ward JL, Leung GP, Toan SV, Tse CM: Functional analysis of site-directed glycosylation mutants of the human equilibrative nucleoside transporter-2. Arch Biochem Biophys. 2003 Mar 1;411(1):19-26. [PubMed:12590919 ]
  8. Owen RP, Lagpacan LL, Taylor TR, De La Cruz M, Huang CC, Kawamoto M, Johns SJ, Stryke D, Ferrin TE, Giacomini KM: Functional characterization and haplotype analysis of polymorphisms in the human equilibrative nucleoside transporter, ENT2. Drug Metab Dispos. 2006 Jan;34(1):12-5. Epub 2005 Oct 7. [PubMed:16214850 ]