Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03244
Secondary Accession Numbers
  • 8816
Name Acyl-CoA dehydrogenase family member 11
Synonyms
  1. ACAD-11
Gene Name ACAD11
Protein Type Enzyme
Biological Properties
General Function Involved in acyl-CoA dehydrogenase activity
Specific Function May function as oxidoreductase (Probable)
Pathways Not Available
Reactions Not Available
GO Classification
Function
oxidoreductase activity, acting on the ch-ch group of donors
acyl-coa dehydrogenase activity
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
oxidoreductase activity
fad or fadh2 binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Peroxisome
Gene Properties
Chromosome Location Chromosome:3
Locus 3q22.1
SNPs ACAD11
Gene Sequence
>2343 bp
ATGAAGCCAGGTGCTACTGGCGAGTCCGATTTGGCCGAAGTGCTGCCCCAGCACAAGTTC
GACAGCAAGTCCCTGGAGGCCTACCTAAACCAGCACTTGTCTGGCTTTGGGGCCGAACGT
GAGGCTACGCTGACCATTGCCCAGTACAGAGCAGGAAAGTCCAATCCAACCTTTTATCTC
CAGAAGGGCTTTCAAACATATGTGCTCAGGAAAAAACCACCAGGTTCACTTCTTCCTAAA
GCACATCAGATTGATAGAGAATTTAAAGTCCAGAAAGCCTTGTTTTCAATTGGATTCCCC
GTTCCCAAGCCTATACTGTACTGCAGTGATACTTCTGTCATTGGAACAGAATTTTACGTA
ATGGAACATGTGCAGGGTCGAATCTTCCGTGATTTAACAATTCCTGGACTTAGCCCAGCA
GAACGTTCAGCCATATATGTGGCCACGGTAGAAACATTGGCTCAGTTACATTCCTTGAAT
ATACAGTCACTGCAGCTGGAAGGATATGGTATAGGTGCTGGGTACTGCAAAAGACAGGTA
TCAACCTGGACAAAGCAATATCAAGCTGCAGCTCATCAGGACATCCCTGCCATGCAACAG
CTATCGGAGTGGCTAATGAAGAACTTGCCCGATAATGACAATGAAGAGAATTTGATTCAT
GGAGATTTCAGACTAGATAACATAGTTTTCCACCCTAAAGAGTGTCGAGTTATAGCAGTG
CTGGATTGGGAGCTGTCAACCATTGGTCATCCTTTGTCAGACTTAGCTCATTTTTCCCTG
TTCTACTTTTGGCCAAGGACAGTTCCAATGATAAATCAAGGTTCTTATAGTGAAAACTCA
GGGATACCATCAATGGAAGAACTGATTTCAATATATTGCCGCTGCAGGGGAATTAATTCT
ATTCTTCCTAACTGGAATTTCTTTCTTGCCCTTTCATATTTTAAGATGGCTGGAATAGCA
CAGGGAGTATATAGCAGATATCTTCTGGGAAATAATTCATCTGAGGATAGCTTTTTATTT
GCCAATATTGTGCAACCTCTGGCAGAAACTGGACTACAACTCTCCAAACGAACTTTCAGT
ACTGTACTACCACAGATTGATACTACTGGACAGTTGTTTGTACAGACTCGGAAAGGTCAG
GAAGTTCTTATTAAGGTGAAGCATTTCATGAAACAACACATTCTTCCAGCTGAAAAGGAG
GTAACTGAGTTCTATGTTCAAAATGAAAATTCAGTGGACAAGTGGGGAAAACCTTTAGTG
ATTGATAAACTCAAGGAAATGGCCAAAGTCGAGGGTCTCTGGAACTTGTTTTTGCCAGCT
GTCAGCGGACTCAGCCACGTGGACTATGCCTTGATTGCTGAAGAAACAGGAAAATGCTTT
TTTGCTCCAGATGTCTTTAACTGCCAAGCACCAGACACAGGGAATATGGAGGTTCTGCAC
CTGTATGGAAGTGAGGAACAGAAGAAACAGTGGCTTGAGCCTCTTCTTCAAGGGAACATT
ACCTCTTGCTTCTGTATGACAGAACCTGATGTAGCTTCAAGTGATGCCACGAATATTGAA
TGCAGCATCCAACGAGATGAAGATAGCTATGTAATTAACGGCAAAAAATGGTGGAGCAGT
GGAGCTGGGAATCCCAAGTGCAAAGTTGCAATTGTTTTGGGAAGAACTCAAAATACTTCT
CTCTCCAGACACAAACAGCACAGCATGATTCTTGTTCCCATGAACACACCTGGAGTAAAA
ATAATAAGGCCTTTGTCAGTTTTTGGCTACACAGATAATTTTCATGGAGGACATTTTGAG
ATCCATTTTAATCAAGTGCGAGTTCCTGCCACAAATCTAATACTAGGTGAAGGTAGGGGA
TTTGAAATTTCCCAAGGCCGCCTTGGACCTGGCAGAATCCACCACTGTATGAGAACAGTA
GGTTTGGCGGAACGCGCTTTGCAGATCATGTGTGAGCGGGCAACACAAAGGATAGCTTTC
AAGAAGAAGTTGTATGCACATGAGGTTGTGGCTCACTGGATTGCTGAAAGCCGCATTGCC
ATTGAGAAGATCCGCTTGTTGACTCTGAAAGCTGCTCACAGCATGGACACTCTGGGCAGT
GCTGGCGCTAAGAAAGAGATTGCAATGATCAAAGTGGCTGCCCCACGGGCTGTCAGCAAA
ATCGTTGACTGGGCCATCCAGGTGTGCGGAGGTGCTGGTGTTTCCCAGGATTACCCTCTG
GCTAACATGTATGCTATAACCCGAGTTTTGCGTTTAGCAGATGGACCTGACGAAGTTCAT
CTTTCAGCAATCGCAACAATGGAGCTGCGGGACCAAGCCAAAAGACTGACAGCCAAGATA
TAA
Protein Properties
Number of Residues 780
Molecular Weight 87282.7
Theoretical pI 8.21
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Acyl-CoA dehydrogenase family member 11
MKPGATGESDLAEVLPQHKFDSKSLEAYLNQHLSGFGAEREATLTIAQYRAGKSNPTFYL
QKGFQTYVLRKKPPGSLLPKAHQIDREFKVQKALFSIGFPVPKPILYCSDTSVIGTEFYV
MEHVQGRIFRDLTIPGLSPAERSAIYVATVETLAQLRSLNIQSLQLEGYGIGAGYCKRQV
STWTKQYQAAAHQDIPAMQQLSEWLMKNLPDNDNEENLIHGDFRLDNIVFHPKECRVIAV
LDWELSTIGHPLSDLAHFSLFYFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINS
ILPNWNFFLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPLAETGLQLSKRTFS
TVLPQIDTTGQLFVQTRKGQEVLIKVKHFMKQHILPAEKEVTEFYVQNENSVDKWGKPLV
IDKLKEMAKVEGLWNLFLPAVSGLSHVDYALIAEETGKCFFAPDVFNCQAPDTGNMEVLH
LYGSEEQKKQWLEPLLQGNITSCFCMTEPDVASSDATNIECSIQRDEDSYVINGKKWWSS
GAGNPKCKIAIVLGRTQNTSLSRHKQHSMILVPMNTPGVKIIRPLSVFGYTDNFHGGHFE
IHFNQVRVPATNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERALQIMCERATQRIAF
KKKLYAHEVVAHWIAESRIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSK
IVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI
GenBank ID Protein 38490142
UniProtKB/Swiss-Prot ID Q709F0
UniProtKB/Swiss-Prot Entry Name ACD11_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ608287
GeneCard ID ACAD11
GenAtlas ID ACAD11
HGNC ID HGNC:30211
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]