Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03259
Secondary Accession Numbers
  • 8833
  • HMDBP05948
Name Sodium-dependent proline transporter
Synonyms
  1. Solute carrier family 6 member 7
Gene Name SLC6A7
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Terminates the action of proline by its high affinity sodium-dependent reuptake into presynaptic terminals.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
proline transport
transmembrane transport
Cellular Component
integral to plasma membrane
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
transmembrane transporter activity
transporter activity
Molecular Function
neurotransmitter:sodium symporter activity
L-proline transmembrane transporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 5
Locus 5q32
SNPs SLC6A7
Gene Sequence
>1911 bp
ATGAAGAAGCTCCAGGGAGCTCACCTCCGCAAGCCTGTCACCCCAGACCTGCTGATGACC
CCCAGTGACCAGGGCGATGTCGACCTGGATGTGGACTTTGCTGCACACCGGGGGAACTGG
ACAGGCAAGCTGGACTTCCTGCTGTCCTGCATTGGCTACTGTGTAGGCCTGGGGAATGTC
TGGCGCTTCCCCTATCGAGCGTACACCAATGGAGGAGGCGCCTTCCTCGTGCCCTACTTC
CTCATGCTGGCCATCTGTGGCATCCCCCTCTTCTTCCTGGAGCTCTCCCTGGGCCAGTTC
TCCAGCCTAGGGCCCCTGGCTGTCTGGAAAATCAGCCCTCTCTTCAAAGGCGCCGGCGCA
GCCATGCTGCTCATCGTGGGCTTGGTGGCCATCTACTACAACATGATCATCGCCTACGTG
CTCTTCTACCTCTTCGCCTCCCTCACCAGCGACCTACCCTGGGAGCACTGTGGCAACTGG
TGGAACACAGAACTCTGCCTGGAGCACAGAGTCTCCAAGGACGGCAACGGGGCCCTGCCC
CTCAACCTCACCTGCACCGTCAGCCCCAGCGAGGAGTACTGGAGCCGCTACGTCCTCCAC
ATCCAAGGCAGCCAGGGCATCGGCAGCCCTGGGGAGATCCGCTGGAACCTCTGCCTCTGC
CTGCTGCTGGCCTGGGTCATCGTGTTCCTCTGTATCCTCAAGGGTGTGAAGTCTTCGGGC
AAGGTGGTGTATTTCACGGCCACGTTCCCCTACCTCATCCTGCTCATGCTGCTGGTCCGC
GGAGTCACCCTCCCAGGGGCCTGGAAGGGCATCCAGTTCTATCTCACCCCCCAGTTCCAC
CACTTGTTGTCTTCCAAGGTGTGGATTGAAGCTGCTCTTCAGATCTTCTATTCCCTGGGT
GTGGGCTTCGGGGGGCTCCTCACCTTTGCCTCCTACAACACGTTTCACCAGAACATCTAT
AGAGACACTTTCATCGTCACTCTGGGCAACGCCATCACCAGCATCCTGGCTGGCTTTGCC
ATCTTCTCCGTGCTGGGCTACATGTCTCAGGAGCTGGGCGTGCCTGTGGACCAAGTAGCC
AAAGCAGGCCCTGGCCTGGCCTTTGTCGTCTACCCACAGGCCATGACCATGCTGCCTCTG
TCACCCTTCTGGTCCTTTCTCTTCTTCTTCATGCTTCTGACTCTCGGCCTAGATAGCCAG
TTTGCTTTTCTGGAGACCATTGTGACAGCTGTGACAGATGAGTTCCCATACTACCTGCGG
CCCAAGAAGGCGGTGTTCTCAGGGCTCATCTGCGTGGCCATGTACCTGATGGGGCTGATC
CTCACCACTGATGGGGGCATGTACTGGCTGGTCCTTCTGGATGACTACAGCGCCAGCTTC
GGGCTGATGGTGGTGGTTATCACCACGTGCCTTGCCGTGACACGGGTGTATGGCATTCAG
AGGTTCTGCCGAGACATCCACATGATGCTGGGCTTCAAGCCGGGCCTCTACTTCAGGGCC
TGCTGGCTGTTCCTGTCCCCAGCCACGCTCTTGGCCCTCATGGTGTATAGCATCGTCAAG
TACCAGCCCTCGGAGTATGGCAGTTACCGCTTCCCGCCCTGGGCTGAGCTGCTGGGCATC
CTGATGGGCCTGCTGTCCTGCCTCATGATCCCAGCTGGCATGCTGGTGGCTGTGCTTCGA
GAAGAGGGCTCACTCTGGGAGCGGCTCCAACAGGCCAGCCGGCCGGCCATGGACTGGGGA
CCATCGCTGGAGGAGAACCGGACGGGCATGTATGTGGCCACGCTGGCTGGGAGCCAGTCA
CCAAAGCCACTGATGGTGCACATGCGCAAGTACGGGGGCATCACCAGCTTCGAGAACACG
GCCATCGAGGTGGACCGTGAGATTGCAGAGGAGGAGGAGTCGATGATGTGA
Protein Properties
Number of Residues 636
Molecular Weight 70909.935
Theoretical pI 6.67
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium-dependent proline transporter
MKKLQGAHLRKPVTPDLLMTPSDQGDVDLDVDFAAHRGNWTGKLDFLLSCIGYCVGLGNV
WRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGA
AMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALP
LNLTCTVSPSEEYWSRYVLHIQGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSG
KVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLG
VGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVA
KAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLR
PKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQ
RFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGI
LMGLLSCLMIPAGMLVAVLREEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQS
PKPLMVHMRKYGGITSFENTAIEVDREIAEEEESMM
GenBank ID Protein 134304856
UniProtKB/Swiss-Prot ID Q99884
UniProtKB/Swiss-Prot Entry Name SC6A7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014228.3
GeneCard ID SLC6A7
GenAtlas ID SLC6A7
HGNC ID HGNC:11054
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  3. Shafqat S, Velaz-Faircloth M, Henzi VA, Whitney KD, Yang-Feng TL, Seldin MF, Fremeau RT Jr: Human brain-specific L-proline transporter: molecular cloning, functional expression, and chromosomal localization of the gene in human and mouse genomes. Mol Pharmacol. 1995 Aug;48(2):219-29. [PubMed:7651355 ]