Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03267
Secondary Accession Numbers
  • 8842
Name Excitatory amino acid transporter 4
Synonyms
  1. Sodium-dependent glutamate/aspartate transporter
  2. Solute carrier family 1 member 6
Gene Name SLC1A6
Protein Type Unknown
Biological Properties
General Function Involved in sodium:dicarboxylate symporter activity
Specific Function Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
organic acid transmembrane transporter activity
carboxylic acid transmembrane transporter activity
dicarboxylic acid transmembrane transporter activity
sodium:dicarboxylate symporter activity
Process
establishment of localization
transport
organic acid transport
carboxylic acid transport
dicarboxylic acid transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.12
SNPs SLC1A6
Gene Sequence
>1695 bp
ATGAGCAGCCATGGCAACAGCCTGTTCCTTCGGGAGAGCGGCCAGCGGCTGGGCCGGGTG
GGCTGGCTGCAGCGGCTGCAGGAAAGCCTGCAGCAGAGAGCACTGCGCACGCGCCTGCGC
CTGCAGACCATGACCCTCGAGCACGTGCTGCGCTTCCTGCGCCGAAACGCCTTCATTCTG
CTGACGGTCAGCGCCGTGGTCATTGGGGTCAGCCTGGCCTTTGCCCTGCGCCCATATCAG
CTCACCTACCGCCAGATCAAGTACTTCTCTTTTCCTGGAGAGCTTCTGATGAGGATGCTG
CAGATGCTGGTGTTACCTCTCATTGTCTCCAGCCTGGTCACAGGTATGGCATCCCTGGAC
AACAAGGCCACGGGGCGGATGGGGATGCGGGCAGCTGTGTACTACATGGTGACCACCATC
ATCGCGGTCTTCATCGGCATCCTCATGGTCACCATCATCCATCCCGGGAAGGGCTCCAAG
GAGGGGCTGCACCGGGAGGGCCGGATCGAGACCATCCCCACAGCTGATGCCTTCATGGAC
CTGATCAGAAATATGTTTCCACCAAACCTTGTGGAGGCCTGCTTCAAACAGTTCAAGACG
CAGTACAGCACGAGGGTGGTAACCAGGACCATGGTGAGGACAGAGAACGGGTCTGAGCCG
GGTGCCTCCATGCCTCCTCCATTCTCAGTGGAGAACGGAACCAGCTTCCTGGAAAATGTC
ACTCGGGCCTTGGGTACCCTGCAGGAGATGCTGAGCTTTGAGGAGACTGTACCCGTGCCT
GGCTCCGCCAATGGCATCAACGCCCTGGGCCTCGTGGTCTTCTCTGTGGCCTTTGGGCTG
GTCATTGGTGGCATGAAACACAAGGGCAGAGTCCTCAGGGACTTCTTCGACAGCCTCAAT
GAGGCTATTATGAGGCTGGTGGGCATCATTATCTGGTATGCACCTGTGGGCATCCTGTTC
CTGATTGCTGGGAAGATTCTGGAGATGGAAGACATGGCCGTCCTGGGGGGTCAGCTGGGC
ATGTACACCCTGACCGTCATCGTGGGCCTGTTCCTCCATGCCGGCATTGTCCTTCCCCTC
ATCTACTTCCTCGTCACTCACCGGAACCCCTTCCCCTTCATTGGGGGCATGCTACAAGCC
CTCATCACCGCTATGGGCACGTCTTCCAGCTCGGCAACGCTGCCCATCACCTTCCGCTGC
CTGGAGGAGGGCCTGGGTGTGGACCGCCGCATCACCAGGTTCGTCCTGCCCGTGGGCGCC
ACGGTCAACATGGATGGCACTGCCCTCTACGAGGCCCTGGCTGCCATCTTCATTGCTCAA
GTTAACAACTACGAGCTCAACCTGGGTCAGATCACAACCATCAGCATCACGGCCACAGCA
GCCAGTGTTGGGGCTGCTGGCATCCCCCAGGCGGGTCTGGTCACCATGGTCATTGTGCTT
ACGTCGGTCGGCTTGCCCACGGAAGACATCACGCTCATCATCGCCGTGGACTGGTTCCTT
GACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCATCGAG
CACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGG
AAACCCTACAAGTCCCTCATGGCACAGGAGAAGGGGGCATCCCGGGGACGGGGAGGCAAC
GAGAGTGCTATGTGA
Protein Properties
Number of Residues 564
Molecular Weight 61564.9
Theoretical pI 9.54
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 56-76
  • 99-119
  • 133-153
  • 265-285
  • 306-326
  • 345-365
  • 370-390
  • 418-438
  • 460-480
  • 481-501
Protein Sequence
>Excitatory amino acid transporter 4
MSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTMTLEHVLRFLRRNAFIL
LTVSAVVIGVSLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMASLD
NKATGRMGMRAAVYYMVTTIIAVFIGILMVTIIHPGKGSKEGLHREGRIETIPTADAFMD
LIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENV
TRALGTLQEMLSFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFDSLN
EAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGIVLPL
IYFLVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLPVGA
TVNMDGTALYEALAAIFIAQVNNYELNLGQITTISITATAASVGAAGIPQAGLVTMVIVL
TSVGLPTEDITLIIAVDWFLDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLG
KPYKSLMAQEKGASRGRGGNESAM
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P48664
UniProtKB/Swiss-Prot Entry Name EAA4_HUMAN
PDB IDs Not Available
GenBank Gene ID U18244
GeneCard ID SLC1A6
GenAtlas ID SLC1A6
HGNC ID HGNC:10944
References
General References
  1. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  2. Fairman WA, Vandenberg RJ, Arriza JL, Kavanaugh MP, Amara SG: An excitatory amino-acid transporter with properties of a ligand-gated chloride channel. Nature. 1995 Jun 15;375(6532):599-603. [PubMed:7791878 ]