You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03302
Secondary Accession Numbers
  • 8881
  • HMDBP03334
Name Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)
Synonyms
  1. Amino acid transporter ATB0+
  2. Solute carrier family 6 member 14
Gene Name SLC6A14
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Mediates the uptake of a broad range of neutral and cationic amino acids (with the exception of proline) in a Na(+)/Cl(-)-dependent manner
Pathways Not Available
Reactions Not Available
GO Classification
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
transmembrane transporter activity
transporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SLC6A14
Gene Sequence
>1929 bp
ATGGACAAGTTGAAATGCCCGAGTTTCTTCAAGTGCAGGGAGAAGGAGAAAGTGTCGGCT
TCATCAGAGAATTTCCATGTTGGTGAAAATGATGAGAATCAGGACCGTGGTAACTGGTCC
AAAAAATCGGATTATCTTCTATCTATGATTGGATACGCAGTGGGATTAGGAAATGTGTGG
AGATTTCCATATCTGACCTACAGCAATGGTGGAGGCGCCTTCTTGATACCTTATGCAATT
ATGTTAGCATTGGCTGGTTTACCTTTGTTCTTTCTGGAGTGTTCACTGGGACAATTTGCT
AGCTTAGGTCCAGTTTCAGTTTGGAGGATTCTTCCATTGTTTCAAGGTGTGGGAATTACA
ATGGTCCTGATCTCCATTTTTGTGACAATCTATTACAATGTCATAATTGCCTATAGTCTT
TACTACATGTTTGCTTCTTTTCAAAGTGAACTACCATGGAAAAATTGTTCTTCGTGGTCA
GATAAAAACTGTAGCAGATCACCAATAGTAACTCACTGTAATGTGAGTACAGTGAATAAA
GGAATACAAGAGATCATCCAAATGAATAAAAGCTGGGTAGACATCAACAATTTTACCTGC
ATCAACGGCAGTGAAATTTATCAGCCAGGGCAGCTTCCCAGTGAACAATATTGGAATAAA
GTGGCGCTCCAACGGTCAAGTGGAATGAATGAGACTGGAGTAATTGTTTGGTATTTAGCA
CTTTGTCTTCTTCTGGCTTGGCTCATAGTTGGAGCAGCACTATTTAAAGGAATCAAATCG
TCTGGCAAGGTGGTATATTTTACAGCTCTTTTCCCCTATGTGGTCCTACTCATCCTGTTA
GTACGAGGTGCAACTCTGGAGGGTGCTTCAAAAGGCATTTCATACTATATTGGAGCCCAG
TCAAATTTTACAAAACTTAAGGAAGCTGAGGTATGGAAAGATGCTGCCACTCAGATATTT
TACTCCCTTTCAGTGGCTTGGGGTGGCTTAGTTGCTCTATCATCTTACAATAAGTTCAAA
AACAACTGCTTCTCTGATGCCATTGTGGTTTGTTTGACAAACTGTCTCACTAGCGTGTTT
GCTGGATTTGCTATTTTTTCTATATTGGGACACATGGCCCATATATCTGGAAAGGAAGTT
TCTCAAGTTGTAAAATCAGGTTTTGATTTGGCATTCATTGCCTATCCAGAGGCTCTAGCC
CAACTCCCAGGTGGTCCATTTTGGTCCATATTATTTTTTTTCATGCTTTTAACTTTGGGT
CTCGATTCTCAGTTTGCTTCGATTGAAACGATCACAACAACAATTCAAGATTTATTTCCC
AAAGTGATGAAGAAAATGAGGGTTCCCATAACTTTGGGCTGCTGCTTGGTTTTGTTTCTC
CTTGGTCTCGTCTGTGTGACTCAGGCTGGAATTTACTGGGTTCATCTGATTGACCACTTC
TGTGCTGGATGGGGCATTTTAATTGCAGCTATACTGGAGCTAGTTGGAATCATCTGGATT
TATGGAGGGAACAGATTCATTGAGGATACAGAAATGATGATTGGAGCAAAGAGGTGGATA
TTCTGGCTATGGTGGAGAGCTTGCTGGTTTGTAATTACGCCTATCCTTTTGATTGCAATA
TTTATCTGGTCATTGGTGCAATTTCATAGACCTAATTATGGCGCAATTCCATACCCTGAC
TGGGGAGTTGCTTTAGGCTGGTGTATGATTGTTTTCTGCATTATTTGGATACCAATTATG
GCTATCATAAAAATAATTCAGGCTAAAGGAAACATCTTTCAACGCCTTATAAGTTGCTGC
AGACCAGCTTCTAACTGGGGTCCATACCTGGAACAACATCGTGGGGAAAGATATAAAGAC
ATGGTAGATCCTAAAAAAGAGGCTGACCATGAAATACCTACTGTTAGTGGCAGCAGAAAA
CCGGAATGA
Protein Properties
Number of Residues 642
Molecular Weight 72152.1
Theoretical pI 8.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 45-65
  • 72-92
  • 110-130
  • 235-255
  • 261-281
  • 315-335
  • 348-368
  • 399-419
  • 450-477
  • 480-500
  • 528-548
  • 563-583
Protein Sequence
>Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)
MDKLKCPSFFKCREKEKVSASSENFHVGENDENQDRGNWSKKSDYLLSMIGYAVGLGNVW
RFPYLTYSNGGGAFLIPYAIMLALAGLPLFFLECSLGQFASLGPVSVWRILPLFQGVGIT
MVLISIFVTIYYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNK
GIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLA
LCLLLAWLIVGAALFKGIKSSGKVVYFTALFPYVVLLILLVRGATLEGASKGISYYIGAQ
SNFTKLKEAEVWKDAATQIFYSLSVAWGGLVALSSYNKFKNNCFSDAIVVCLTNCLTSVF
AGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFWSILFFFMLLTLG
LDSQFASIETITTTIQDLFPKVMKKMRVPITLGCCLVLFLLGLVCVTQAGIYWVHLIDHF
CAGWGILIAAILELVGIIWIYGGNRFIEDTEMMIGAKRWIFWLWWRACWFVITPILLIAI
FIWSLVQFHRPNYGAIPYPDWGVALGWCMIVFCIIWIPIMAIIKIIQAKGNIFQRLISCC
RPASNWGPYLEQHRGERYKDMVDPKKEADHEIPTVSGSRKPE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UN76
UniProtKB/Swiss-Prot Entry Name S6A14_HUMAN
PDB IDs Not Available
GenBank Gene ID AF151978
GeneCard ID SLC6A14
GenAtlas ID SLC6A14
HGNC ID HGNC:11047
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  3. Sloan JL, Mager S: Cloning and functional expression of a human Na(+) and Cl(-)-dependent neutral and cationic amino acid transporter B(0+). J Biol Chem. 1999 Aug 20;274(34):23740-5. [PubMed:10446133 ]
  4. Tiwari HK, Allison DB: Do allelic variants of SLC6A14 predispose to obesity? J Clin Invest. 2003 Dec;112(11):1633-6. [PubMed:14660737 ]
  5. Suviolahti E, Oksanen LJ, Ohman M, Cantor RM, Ridderstrale M, Tuomi T, Kaprio J, Rissanen A, Mustajoki P, Jousilahti P, Vartiainen E, Silander K, Kilpikari R, Salomaa V, Groop L, Kontula K, Peltonen L, Pajukanta P: The SLC6A14 gene shows evidence of association with obesity. J Clin Invest. 2003 Dec;112(11):1762-72. [PubMed:14660752 ]