You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03317
Secondary Accession Numbers
  • 8899
Name Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
Synonyms
  1. Alpha-2-glucosyltransferase ALG10-A
  2. Asparagine-linked glycosylation protein 10 homolog A
  3. Alpha-1,2-glucosyltransferase ALG10-A
Gene Name ALG10
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring hexosyl groups
Specific Function Adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc(2)Man(9)GlcNAc(2)-PP-Dol.
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
Reactions
Dolichyl b-D-glucosyl phosphate → Dolichol-20 details
Dolichyl D-glucosyl phosphate + → Dolichyl phosphate + details
GO Classification
Biological Process
dolichol-linked oligosaccharide biosynthetic process
post-translational protein modification
protein N-linked glycosylation via asparagine
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
transferase activity, transferring hexosyl groups
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 12
Locus 12p11.1
SNPs ALG10
Gene Sequence
>1422 bp
ATGGCGCAGCTGGAAGGTTACTATTTCTCGGCCGCCTTGAGCTGTACCTTTTTAGTATCC
TGCCTCCTCTTCTCCGCCTTCAGCCGGGCGTTGCGAGAGCCCTACATGGACGAGATCTTC
CACCTGCCTCAGGCGCAGCGCTACTGTGAGGGCCATTTCTCCCTTTCCCAGTGGGATCCC
ATGATTACTACATTACCTGGCTTGTACCTGGTGTCAATTGGAGTGATCAAACCTGCCATT
TGGATCTTTGGATGGTCTGAACATGTTGTCTGCTCCATTGGGATGCTCAGATTTGTTAAT
CTTCTCTTCAGTGTTGGCAACTTCTATTTACTATATTTGCTTTTCTGCAAGGTACAACCC
AGAAACAAGGCTGCCTCAAGTATCCAGAGAGTCTTGTCAACATTAACACTAGCAGTATTT
CCAACACTTTATTTTTTTAACTTCCTTTATTATACAGAAGCAGGATCTATGTTTTTTACT
CTTTTTGCGTATTTGATGTGTCTTTATGGAAATCATAAAACTTCAGCCTTCCTTGGATTT
TGTGGCTTCATGTTTCGGCAAACAAATATCATCTGGGCTGTCTTCTGTGCAGGAAATGTC
ATTGCACAAAAGTTAACGGAGGCTTGGAAAACTGAGCTACAAAAGAAGGAAGACAGACTT
CCACCTATTAAAGGACCATTTGCAGAATTCAGAAAAATTCTTCAGTTTCTTTTGGCTTAT
TCCATGTCCTTTAAAAACTTGAGTATGCTTTTGCTTCTGACTTGGCCCTACACCCTTCTG
GGATTTCTGTTTTGTGCTTTTGTAGTAGTTAATGGTGGAATTGTTATTGGCGATCGGAGT
AGTCATGAAGCCTGTCTTCATTTTCCTCAACTATTCTACTTTTTTTCATTTACTCTCTTT
TTTTCCTTTCCTCATCTCCTGTCTCCTAGCAAAATTAAGACTTTTCTTTCCTTAGTTTGG
AAACGTAGAATTCTGTTTTTTGTGGTTACCTTAGTCTCTGTGTTTTTAGTTTGGAAATTC
ACTTATGCTCATAAATACTTGCTAGCAGACAATAGACATTATACTTTCTATGTGTGGAAA
AGAGTTTTTCAAAGATATGAAACTGTAAAATATTTGTTAGTTCCAGCCTATATATTTGCT
GGTTGGAGTATAGCTGACTCATTGAAATCAAAGTCAATTTTTTGGAATTTAATGTTTTTC
ATATGCTTGTTCACTGTTATAGTTCCTCAGAAACTGCTGGAATTTCGTTACTTCATTTTA
CCTTATGTCATTTATAGGCTTAACATACCTCTGCCTCCCACATCCAGACTCATTTGTGAA
CTGAGCTGCTATGCAGTTGTTAATTTCATAACTTTTTTCATCTTTCTGAACAAGACTTTT
CAGTGGCCAAATAGTCAGGACATTCAAAGGTTTATGTGGTAA
Protein Properties
Number of Residues 473
Molecular Weight 55605.48
Theoretical pI 9.29
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alpha-1,2-glucosyltransferase ALG10-A
MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDP
MITTLPGLYLVSIGVIKPAIWIFGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFCKVQP
RNKAASSIQRVLSTLTLAVFPTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGF
CGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAY
SMSFKNLSMLLLLTWPYILLGFLFCAFVVVNGGIVIGDRSSHEACLHFPQLFYFFSFTLF
FSFPHLLSPSKIKTFLSLVWKRRILFFVVTLVSVFLVWKFTYAHKYLLADNRHYTFYVWK
RVFQRYETVKYLLVPAYIFAGWSIADSLKSKSIFWNLMFFICLFTVIVPQKLLEFRYFIL
PYVIYRLNIPLPPTSRLICELSCYAVVNFITFFIFLNKTFQWPNSQDIQRFMW
GenBank ID Protein 14349125
UniProtKB/Swiss-Prot ID Q5BKT4
UniProtKB/Swiss-Prot Entry Name AG10A_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ312278
GeneCard ID ALG10
GenAtlas ID ALG10
HGNC ID HGNC:23162
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  4. Oriol R, Martinez-Duncker I, Chantret I, Mollicone R, Codogno P: Common origin and evolution of glycosyltransferases using Dol-P-monosaccharides as donor substrate. Mol Biol Evol. 2002 Sep;19(9):1451-63. [PubMed:12200473 ]