You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03575
Secondary Accession Numbers
  • 9163
Name Ethanolamine-phosphate phospho-lyase
Synonyms
  1. Alanine--glyoxylate aminotransferase 2-like 1
Gene Name AGXT2L1
Protein Type Enzyme
Biological Properties
General Function Involved in transaminase activity
Specific Function Catalyzes the pyridoxal-phosphate-dependent breakdown of phosphoethanolamine, converting it to ammonia, inorganic phosphate and acetaldehyde.
Pathways Not Available
Reactions
O-Phosphoethanolamine + Water → Acetaldehyde + Ammonia + Phosphate details
GO Classification
Biological Process
cellular amino acid metabolic process
Cellular Component
mitochondrion
Function
binding
catalytic activity
transferase activity
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
transaminase activity
Molecular Function
pyridoxal phosphate binding
alanine-glyoxylate transaminase activity
ethanolamine-phosphate phospho-lyase activity
Cellular Location
  1. Mitochondrion (Potential)
Gene Properties
Chromosome Location 4
Locus 4q25
SNPs AGXT2L1
Gene Sequence
>1500 bp
ATGTGCGAGCTGTACAGTAAGCGGGACACTCTGGGGCTGAGGAAGAAGCACATCGGGCCC
TCATGCAAAGTTTTCTTTGCATCGGATCCCATCAAAATAGTGAGAGCCCAGAGGCAGTAC
ATGTTTGATGAGAACGGTGAACAGTACTTGGACTGCATCAACAATGTTGCCCATGTGGGA
CACTGTCACCCAGGAGTGGTCAAAGCTGCCCTGAAACAGATGGAACTGCTAAATACAAAT
TCTCGATTCCTCCACGACAACATTGTTGAGTATGCCAAACGCCTTTCAGCAACTCTGCCG
GAGAAACTCTCTGTTTGTTATTTTACAAATTCAGGATCCGAAGCCAACGACTTAGCCTTA
CGCCTGGCTCGGCAGTTCAGAGGCCACCAGGATGTGATCACTCTTGACCATGCTTACCAT
GGTCACCTATCATCCTTAATTGAGATTAGCCCATATAAGTTTCAGAAAGGAAAAGATGTC
AAAAAAGAATTTGTACATGTGGCACCAACTCCAGATACTTACAGAGGAAAATATAGAGAA
GACCATGCAGACTCAGCCAGTGCTTATGCAGATGAAGTGAAGAAAATCATTGAAGATGCT
CATAACAGTGGAAGGAAGATTGCTGCCTTTATTGCTGAATCCATGCAGAGTTGTGGCGGA
CAAATAATTCCTCCAGCAGGCTACTTCCAGAAAGTGGCAGAATATGTACACGGTGCAGGG
GGTGTGTTTATAGCTGATGAAGTTCAAGTGGGCTTTGGCAGAGTTGGGAAACATTTCTGG
AGCTTCCAGATGTATGGTGAAGACTTTGTTCCAGACATCGTCACAATGGGAAAACCGATG
GGCAACGGCCACCCGGTGGCATGTGTGGTAACAACCAAAGAAATTGCAGAAGCCTTCAGC
AGCTCTGGGATGGAATATTTTAATACGTATGGAGGAAATCCAGTATCTTGTGCTGTTGGT
TTGGCTGTCCTGGATATAATTGAAAATGAAGACCTTCAAGGAAATGCCAAGAGAGTAGGG
AATTATCTCACTGAGTTACTGAAAAAACAGAAGGCTAAACACACTTTGATAGGAGATATT
AGGGGCATTGGCCTTTTTATTGGAATTGATTTAGTGAAGGACCATCTGAAAAGGACCCCT
GCCACAGCTGAAGCTCAGCACATCATCTACAAGATGAAAGAAAAACGAGTGCTTCTCAGT
GCCGATGGACCTCATAGAAATGTACTTAAAATAAAACCACCTATGTGCTTCACTGAAGAA
GATGCAAAGTTCATGGTGGACCAACTTGATAGGATTCTAACAGTTTTAGAAGAAGCTATG
GGAACCAAAACCGAAAGTGTGACCTCTGAGAATACTCCATGCAAAACAAAGATGCTGAAA
GAAGCCCACATAGAACTGCTTAGGGACAGCACCACTGACTCCAAAGAAAATCCCAGCAGA
AAGAGAAATGGAATGTGCACGGATACACATTCACTGCTCAGTAAGAGGCTCAAGACATGA
Protein Properties
Number of Residues 499
Molecular Weight 55039.64
Theoretical pI 8.14
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alanine--glyoxylate aminotransferase 2-like 1
MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVG
HCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLAL
RLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYRE
DHADSASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAG
GVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFS
SSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDI
RGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEE
DAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSR
KRNGMCTDTHSLLSKRLKT
GenBank ID Protein 63992119
UniProtKB/Swiss-Prot ID Q8TBG4
UniProtKB/Swiss-Prot Entry Name AT2L1_HUMAN
PDB IDs Not Available
GenBank Gene ID AC097473
GeneCard ID AGXT2L1
GenAtlas ID AGXT2L1
HGNC ID HGNC:14404
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Lee IS, Muragaki Y, Ideguchi T, Hase T, Tsuji M, Ooshima A, Okuno E, Kido R: Molecular cloning and sequencing of a cDNA encoding alanine-glyoxylate aminotransferase 2 from rat kidney. J Biochem. 1995 Apr;117(4):856-62. [PubMed:7592550 ]