You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03592
Secondary Accession Numbers
  • 9180
Name Proton-coupled amino acid transporter 1
Synonyms
  1. Proton/amino acid transporter 1
  2. Solute carrier family 36 member 1
  3. hPAT1
Gene Name SLC36A1
Protein Type Transporter
Biological Properties
General Function Amino acid transport and metabolism
Specific Function Neutral amino acid/proton symporter. Has a pH-dependent electrogenic transport activity for small amino acids such as glycine, alanine and proline. Besides small apolar L-amino acids, it also recognize their D-enantiomers and selected amino acid derivatives such as gamma-aminobutyric acid
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Lysosome membrane
  3. Multi-pass membrane protein
  4. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:5
Locus 5q33.1
SNPs SLC36A1
Gene Sequence
>1431 bp
ATGTCCACGCAGAGACTTCGGAATGAAGACTACCACGACTACAGCTCCACGGACGTGAGC
CCTGAGGAGAGCCCGTCGGAAGGCCTCAACAACCTCTCCTCCCCGGGCTCCTACCAGCGC
TTTGGTCAAAGCAATAGCACAACATGGTTCCAGACCTTGATCCACCTGTTAAAAGGCAAC
ATTGGCACAGGACTCCTGGGACTCCCTCTGGCGGTGAAAAATGCAGGCATCGTGATGGGT
CCCATCAGCCTGCTGATCATAGGCATCGTGGCCGTGCACTGCATGGGTATCCTGGTGAAA
TGTGCTCACCACTTCTGCCGCAGGCTGAATAAATCCTTTGTGGATTATGGTGATACTGTG
ATGTATGGACTAGAATCCAGCCCCTGCTCCTGGCTCCGGAACCACGCACACTGGGGAAGA
CGTGTTGTGGACTTCTTCCTGATTGTCACCCAGCTGGGATTCTGCTGTGTCTATTTTGTG
TTTCTGGCTGACAACTTTAAACAGGTGATAGAAGCGGCCAATGGGACCACCAATAACTGC
CACAACAATGAGACGGTGATTCTGACGCCTACCATGGACTCGCGACTCTACATGCTCTCC
TTCCTGCCCTTCCTGGTGCTGCTGGTTTTCATCAGGAACCTCCGAGCCCTGTCCATCTTC
TCCCTGTTGGCCAACATCACCATGCTGGTCAGCTTGGTCATGATCTACCAGTTCATTGTT
CAGAGGATCCCAGACCCCAGCCACCTCCCCTTGGTGGCCCCTTGGAAGACCTACCCTCTC
TTCTTTGGCACAGCGATTTTTTCATTTGAAGGCATTGGAATGGTTCTGCCCCTGGAAAAC
AAAATGAAGGATCCTCGGAAGTTCCCACTCATCCTGTACCTGGGCATGGTCATCGTCACC
ATCCTCTACATCAGCCTGGGGTGTCTGGGGTACCTGCAATTTGGAGCTAATATCCAAGGC
AGCATAACCCTCAACCTGCCCAACTGCTGGTTGTACCAGTCAGTTAAGCTGCTGTACTCC
ATCGGGATCTTTTTCACCTACGCACTCCAGTTCTACGTCCCGGCTGAGATCATCATCCCC
TTCTTTGTGTCCCGAGCGCCCGAGCACTGTGAGTTAGTGGTGGACCTGTTTGTGCGCACA
GTGCTGGTCTGCCTGACATGCATCTTGGCCATCCTCATCCCCCGCCTGGACCTGGTCATC
TCCCTGGTGGGCTCCGTGAGCAGCAGCGCCCTGGCCCTCATCATCCCACCGCTCCTGGAG
GTCACCACCTTCTACTCAGAGGGCATGAGCCCCCTCACCATCTTTAAGGACGCCCTGATC
AGCATCCTGGGCTTCGTGGGCTTTGTGGTGGGGACCTATGAGGCTCTCTATGAGCTGATC
CAGCCAAGCAATGCTCCCATCTTCATCAATTCCACCTGTGCCTTCATATAG
Protein Properties
Number of Residues 476
Molecular Weight 53075.0
Theoretical pI 7.0
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 52-72
  • 79-99
  • 142-162
  • 191-211
  • 216-236
  • 258-278
  • 290-310
  • 343-363
  • 373-393
  • 398-418
  • 440-460
Protein Sequence
>Proton-coupled amino acid transporter 1
MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGN
IGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTV
MYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNC
HNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIV
QRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVT
ILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIP
FFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLE
VTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q7Z2H8
UniProtKB/Swiss-Prot Entry Name S36A1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY162213
GeneCard ID SLC36A1
GenAtlas ID SLC36A1
HGNC ID HGNC:18761
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Schroder B, Wrocklage C, Pan C, Jager R, Kosters B, Schafer H, Elsasser HP, Mann M, Hasilik A: Integral and associated lysosomal membrane proteins. Traffic. 2007 Dec;8(12):1676-86. Epub 2007 Sep 26. [PubMed:17897319 ]
  4. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]
  5. Boll M, Foltz M, Rubio-Aliaga I, Daniel H: A cluster of proton/amino acid transporter genes in the human and mouse genomes. Genomics. 2003 Jul;82(1):47-56. [PubMed:12809675 ]
  6. Dorn M, Weiwad M, Markwardt F, Laug L, Rudolph R, Brandsch M, Bosse-Doenecke E: Identification of a disulfide bridge essential for transport function of the human proton-coupled amino acid transporter hPAT1. J Biol Chem. 2009 Aug 14;284(33):22123-32. doi: 10.1074/jbc.M109.023713. Epub 2009 Jun 23. [PubMed:19549785 ]