You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03814
Secondary Accession Numbers
  • 9402
Name Thymidine kinase, cytosolic
Synonyms Not Available
Gene Name TK1
Protein Type Enzyme
Biological Properties
General Function Nucleotide transport and metabolism
Specific Function Not Available
Pathways
  • Beta Ureidopropionase Deficiency
  • Dihydropyrimidinase Deficiency
  • Drug metabolism - other enzymes
  • MNGIE (Mitochondrial Neurogastrointestinal Encephalopathy)
  • Pyrimidine Metabolism
  • Pyrimidine metabolism
  • UMP Synthase Deficiency (Orotic Aciduria)
Reactions
Adenosine triphosphate + Thymidine → ADP + 5-Thymidylic acid details
Adenosine triphosphate + Deoxyuridine → ADP + dUMP details
Floxuridine + Adenosine triphosphate → 5-Fluorodeoxyuridine monophosphate + ADP details
GO Classification
Biological Process
pyrimidine nucleoside salvage
pyrimidine nucleobase metabolic process
DNA replication
protein homotetramerization
Cellular Component
cytosol
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleobase, nucleoside, nucleotide kinase activity
adenyl nucleotide binding
atp binding
nucleoside kinase activity
deoxynucleoside kinase activity
thymidine kinase activity
Molecular Function
thymidine kinase activity
metal ion binding
ATP binding
zinc ion binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 17
Locus 17q23.2-q25.3
SNPs TK1
Gene Sequence
>705 bp
ATGAGCTGCATTAACCTGCCCACTGTGCTGCCCGGCTCCCCCAGCAAGACCCGGGGGCAG
ATCCAGGTGATTCTCGGGCCGATGTTCTCAGGAAAAAGCACAGAGTTGATGAGACGCGTC
CGTCGCTTCCAGATTGCTCAGTACAAGTGCCTGGTGATCAAGTATGCCAAAGACACTCGC
TACAGCAGCAGCTTCTGCACACATGACCGGAACACCATGGAGGCGCTGCCCGCCTGCCTG
CTCCGAGACGTGGCCCAGGAGGCCCTGGGCGTGGCTGTCATAGGCATCGACGAGGGGCAG
TTTTTCCCTGACATCATGGAGTTCTGCGAGGCCATGGCCAACGCCGGGAAGACCGTAATT
GTGGCTGCACTGGATGGGACCTTCCAGAGGAAGCCATTTGGGGCCATCCTGAACCTGGTG
CCGCTGGCCGAGAGCGTGGTGAAGCTGACGGCGGTGTGCATGGAGTGCTTCCGGGAAGCC
GCCTATACCAAGAGGCTCGGCACAGAGAAGGAGGTCGAGGTGATTGGGGGAGCAGACAAG
TACCACTCCGTGTGTCGGCTCTGCTACTTCAAGAAGGCCTCAGGCCAGCCTGCCGGGCCG
GACAACAAAGAGAACTGCCCAGTGCCAGGAAAGCCAGGGGAAGCCGTGGCTGCCAGGAAG
CTCTTTGCCCCACAGCAGATTCTGCAATGCAGCCCTGCCAACTGA
Protein Properties
Number of Residues 234
Molecular Weight 25468.455
Theoretical pI 8.51
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Thymidine kinase, cytosolic
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVI
VAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADK
YHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
GenBank ID Protein 339709
UniProtKB/Swiss-Prot ID P04183
UniProtKB/Swiss-Prot Entry Name KITH_HUMAN
PDB IDs
GenBank Gene ID K02581
GeneCard ID TK1
GenAtlas ID TK1
HGNC ID HGNC:11830
References
General References
  1. Bradshaw HD Jr, Deininger PL: Human thymidine kinase gene: molecular cloning and nucleotide sequence of a cDNA expressible in mammalian cells. Mol Cell Biol. 1984 Nov;4(11):2316-20. [PubMed:6549046 ]
  2. Flemington E, Bradshaw HD Jr, Traina-Dorge V, Slagel V, Deininger PL: Sequence, structure and promoter characterization of the human thymidine kinase gene. Gene. 1987;52(2-3):267-77. [PubMed:3301530 ]
  3. Chang ZF, Huang DY, Chi LM: Serine 13 is the site of mitotic phosphorylation of human thymidine kinase. J Biol Chem. 1998 May 15;273(20):12095-100. [PubMed:9575153 ]