Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03857
Secondary Accession Numbers
  • 9445
Name Chromaffin granule amine transporter
Synonyms
  1. Solute carrier family 18 member 1
  2. VAT1
  3. Vesicular amine transporter 1
Gene Name SLC18A1
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function Involved in the vesicular transport of biogenic amines
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
intrinsic to membrane
integral to membrane
cell
Function
transporter activity
drug transporter activity
Process
transport
physiological process
cellular physiological process
drug transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Multi-pass membrane protein
  3. Cytoplasmic vesicle membrane
Gene Properties
Chromosome Location Chromosome:8
Locus 8p21.3
SNPs SLC18A1
Gene Sequence
>1578 bp
ATGCTCCGGACCATTCTGGATGCTCCCCAGCGGTTGCTGAAGGAGGGGAGAGCGTCCCGG
CAGCTGGTGCTGGTGGTGGTATTCGTCGCTTTGCTCCTGGACAACATGCTGTTTACTGTG
GTGGTGCCAATTGTGCCCACCTTCCTATATGACATGGAGTTCAAAGAAGTCAACTCTTCT
CTGCACCTCGGCCATGCCGGAAGTTCCCCACATGCCCTCGCCTCTCCTGCCTTTTCCACC
ATCTTCTCCTTCTTCAACAACAACACCGTGGCTGTTGAAGAAAGCGTACCTAGTGGAATA
GCATGGATGAATGACACTGCCAGCACCATCCCACCTCCAGCCACTGAAGCCATCTCAGCT
CATAAAAACAACTGCTTGCAAGGCACAGGTTTCTTGGAGGAAGAGATTACCCGGGTCGGG
GTTCTGTTTGCTTCAAAGGCTGTGATGCAACTTCTGGTCAACCCATTCGTGGGCCCTCTC
ACCAACAGGATTGGATATCATATCCCCATGTTTGCTGGCTTTGTTATCATGTTTCTCTCC
ACAGTTATGTTTGCTTTTTCTGGGACCTATACTCTACTCTTTGTGGCCCGAACCCTTCAA
GGCATTGGATCTTCATTTTCATCTGTTGCAGGTCTTGGAATGCTGGCCAGTGTCTACACT
GATGACCATGAGAGAGGACGAGCCATGGGAACTGCTCTGGGGGGCCTGGCCTTGGGGTTG
CTGGTGGGAGCTCCCTTTGGAAGTGTAATGTACGAGTTTGTTGGGAAGTCTGCACCCTTC
CTCATCCTGGCCTTCCTGGCACTACTGGATGGAGCACTCCAGCTTTGCATCCTACAGCCT
TCCAAAGTCTCTCCTGAGAGTGCCAAGGGGACTCCCCTCTTTATGCTTCTCAAAGACCCT
TACATCCTGGTGGCTGCAGGGTCCATCTGCTTTGCCAACATGGGGGTGGCCATCCTGGAG
CCCACACTGCCCATCTGGATGATGCAGACCATGTGCTCCCCCAAGTGGCAGCTGGGTCTA
GCTTTCTTGCCTGCCAGTGTGTCCTACCTCATTGGCACCAACCTCTTTGGTGTGTTGGCC
AACAAGATGGGTCGGTGGCTGTGTTCCCTAATCGGGATGCTGGTAGTAGGTACCAGCTTG
CTCTGTGTTCCTCTGGCTCACAATATTTTTGGTCTCATTGGCCCCAATGCAGGGCTTGGC
CTTGCCATAGGCATGGTGGATTCTTCTATGATGCCCATCATGGGGCACCTGGTGGATCTA
CGCCACACCTCGGTGTATGGGAGTGTCTACGCCATCGCTGATGTGGCTTTTTGCATGGGC
TTTGCTATAGGTCCATCCACCGGTGGTGCCATTGTAAAGGCCATCGGTTTTCCCTGGCTC
ATGGTCATCACTGGGGTCATCAACATCGTCTATGCTCCACTCTGCTACTACCTGCGGAGC
CCCCCGGCAAAGGAAGAGAAGCTTGCTATTCTGAGTCAGGACTGCCCCATGGAGACCCGG
ATGTATGCAACCCAGAAGCCCACGAAGGAATTTCCTCTGGGGGAGGACAGTGATGAGGAG
CCTGACCATGAGGAGTAG
Protein Properties
Number of Residues 525
Molecular Weight 56258.0
Theoretical pI Not Available
Pfam Domain Function
Signals
  • 1-39
Transmembrane Regions
  • 22-42
  • 139-158
  • 168-188
  • 198-218
  • 228-250
  • 257-279
  • 300-319
  • 336-360
  • 366-386
  • 398-418
  • 423-443
  • 449-470
Protein Sequence
>Chromaffin granule amine transporter
MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSS
LHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISA
HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLS
TVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGL
LVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDP
YILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLA
NKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS
PPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
GenBank ID Protein 1314290
UniProtKB/Swiss-Prot ID P54219
UniProtKB/Swiss-Prot Entry Name VMAT1_HUMAN
PDB IDs Not Available
GenBank Gene ID U39905
GeneCard ID SLC18A1
GenAtlas ID SLC18A1
HGNC ID HGNC:10934
References
General References
  1. Erickson JD, Schafer MK, Bonner TI, Eiden LE, Weihe E: Distinct pharmacological properties and distribution in neurons and endocrine cells of two isoforms of the human vesicular monoamine transporter. Proc Natl Acad Sci U S A. 1996 May 14;93(10):5166-71. [PubMed:8643547 ]