You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03918
Secondary Accession Numbers
  • 9506
Name ADP/ATP translocase 3
Synonyms
  1. ADP,ATP carrier protein 3
  2. ADP,ATP carrier protein, isoform T2
  3. ANT 2
  4. ANT 3
  5. Adenine nucleotide translocator 3
  6. Solute carrier family 25 member 6
Gene Name SLC25A6
Protein Type Enzyme
Biological Properties
General Function Involved in transporter activity
Specific Function Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Mitochondrion inner membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SLC25A6
Gene Sequence
>897 bp
ATGACGGAACAGGCCATCTCCTTCGCCAAAGACTTCTTGGCCGGAGGCATCGCCGCCGCC
ATCTCCAAGACGGCCGTGGCTCCGATCGAGCGGGTCAAGCTGCTGCTGCAGGTCCAGCAC
GCCAGCAAGCAGATCGCCGCCGACAAGCAGTACAAGGGCATCGTGGACTGCATTGTCCGC
ATCCCCAAGGAGCAGGGCGTGCTGTCCTTCTGGAGGGGCAACCTTGCCAACGTCATTCGC
TACTTCCCCACTCAAGCCCTCAACTTCGCCTTCAAGGATAAGTACAAGCAGATCTTCCTG
GGGGGCGTGGACAAGCACACGCAGTTCTGGAGGTACTTTGCGGGCAACCTGGCCTCCGGC
GGTGCGGCCGGCGCGACCTCCCTCTGCTTCGTGTACCCGCTGGATTTCGCCAGAACCCGC
CTGGCAGCGGACGTGGGAAAGTCAGGCACAGAGCGCGAGTTCCGAGGCCTGGGAGACTGC
CTGGTGAAGATCACCAAGTCCGACGGCATCCGGGGCCTGTACCAGGGCTTCAGTGTCTCC
GTGCAGGGCATCATCATCTACCGGGCGGCCTACTTCGGCGTGTACGATACGGCCAAGGGC
ATGCTCCCCGACCCCAAGAACACGCACATCGTGGTGAGCTGGATGATCGCGCAGACCGTG
ACGGCCGTGGCCGGCGTGGTGTCCTACCCCTTCGACACGGTGCGGCGGCGCATGATGATG
CAGTCCGGGCGCAAAGGAGCTGACATCATGTACACGGGCACCGTCGACTGTTGGAGGAAG
ATCTTCAGAGATGAGGGGGGCAAGGCCTTCTTCAAGGGTGCGTGGTCCAACGTCCTGCGG
GGCATGGGGGGCGCCTTCGTGCTGGTCCTGTACGACGAGCTCAAGAAGGTGATCTAA
Protein Properties
Number of Residues 298
Molecular Weight 32866.0
Theoretical pI 10.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 5-39
  • 75-100
  • 109-143
  • 176-202
  • 207-241
  • 273-298
Protein Sequence
>ADP/ATP translocase 3
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCLVKITKSDGIRGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P12236
UniProtKB/Swiss-Prot Entry Name ADT3_HUMAN
PDB IDs
GenBank Gene ID AY007135
GeneCard ID SLC25A6
GenAtlas ID SLC25A6
HGNC ID HGNC:10992
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Verrier F, Mignotte B, Jan G, Brenner C: Study of PTPC composition during apoptosis for identification of viral protein target. Ann N Y Acad Sci. 2003 Dec;1010:126-42. [PubMed:15033708 ]
  6. Zamarin D, Garcia-Sastre A, Xiao X, Wang R, Palese P: Influenza virus PB1-F2 protein induces cell death through mitochondrial ANT3 and VDAC1. PLoS Pathog. 2005 Sep;1(1):e4. Epub 2005 Sep 30. [PubMed:16201016 ]
  7. Cozens AL, Runswick MJ, Walker JE: DNA sequences of two expressed nuclear genes for human mitochondrial ADP/ATP translocase. J Mol Biol. 1989 Mar 20;206(2):261-80. [PubMed:2541251 ]
  8. Houldsworth J, Attardi G: Two distinct genes for ADP/ATP translocase are expressed at the mRNA level in adult human liver. Proc Natl Acad Sci U S A. 1988 Jan;85(2):377-81. [PubMed:2829183 ]
  9. Deniaud A, Brenner C, Kroemer G: Mitochondrial membrane permeabilization by HIV-1 Vpr. Mitochondrion. 2004 Jul;4(2-3):223-33. [PubMed:16120388 ]