Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03945
Secondary Accession Numbers
  • 9533
Name Vesicular glutamate transporter 3
Synonyms
  1. Solute carrier family 17 member 8
  2. VGluT3
Gene Name SLC17A8
Protein Type Unknown
Biological Properties
General Function Involved in transmembrane transport
Specific Function Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
Pathways
  • Glutamatergic synapse
  • Nicotine addiction
  • Retrograde endocannabinoid signaling
  • Synaptic vesicle cycle
Reactions Not Available
GO Classification
Biological Process
sensory perception of sound
ion transport
sodium ion transport
neurotransmitter transport
transmembrane transport
Cellular Component
cell junction
neuron projection
integral to membrane
synaptic vesicle membrane
Molecular Function
symporter activity
L-glutamate transmembrane transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Membrane
  3. Multi-pass membrane protein (Potential)
  4. secretory vesicle
  5. Cell junction
  6. synapse
  7. synaptosome
  8. synaptic vesicle membrane
Gene Properties
Chromosome Location 12
Locus 12q23.1
SNPs SLC17A8
Gene Sequence
>1770 bp
ATGCCTTTTAAAGCATTTGATACCTTCAAAGAAAAAATTCTGAAACCTGGGAAGGAAGGA
GTGAAGAACGCCGTGGGAGATTCTTTGGGAATTTTACAAAGAAAAATCGATGGGACAACT
GAGGAAGAAGATAACATTGAGCTGAATGAAGAAGGAAGGCCGGTGCAGACGTCCAGGCCA
AGCCCCCCACTCTGCGACTGCCACTGCTGCGGCCTCCCCAAGCGTTACATCATTGCTATC
ATGAGTGGGCTGGGATTCTGCATTTCCTTTGGGATCCGGTGCAATCTTGGAGTTGCCATT
GTGGAAATGGTCAACAATAGCACCGTATATGTTGATGGAAAACCGGAAATTCAGACAGCA
CAGTTTAACTGGGATCCAGAAACAGTGGGCCTTATCCATGGATCTTTTTTCTGGGGCTAT
ATTATGACACAAATTCCAGGTGGTTTCATTTCAAACAAGTTTGCTGCTAACAGGGTCTTT
GGAGCTGCCATCTTCTTAACATCGACTCTGAACATGTTTATTCCCTCTGCAGCCAGAGTG
CATTACGGATGCGTCATGTGTGTCAGAATTCTGCAAGGTTTAGTGGAGGGTGTGACCTAC
CCAGCCTGCCATGGGATGTGGAGTAAGTGGGCACCACCTTTGGAGAGAAGCCGACTGGCC
ACAACCTCTTTTTGTGGTTCCTATGCAGGGGCAGTGGTTGCCATGCCCCTGGCTGGGGTG
TTGGTGCAGTACATTGGATGGTCCTCTGTCTTTTATATTTATGGCATGTTTGGGATTATT
TGGTACATGTTTTGGCTGTTGCAGGCCTATGAGTGCCCAGCAGCTCATCCAACAATATCC
AATGAGGAGAAGACCTATATAGAGACAAGCATAGGAGAGGGGGCCAACGTGGTTAGTCTA
AGTAAATTTAGTACCCCATGGAAAAGATTTTTCACATCTTTGCCGGTTTACGCAATCATT
GTGGCAAATTTTTGCAGAAGCTGGACCTTTTATTTGCTCCTCATAAGTCAGCCTGCTTAT
TTTGAAGAGGTCTTTGGATTTGCAATAAGTAAGGTGGGTCTCTTGTCAGCAGTCCCACAC
ATGGTTATGACAATCGTTGTACCTATTGGAGGACAATTGGCTGATTATTTAAGAAGCAGA
CAAATTTTAACCACAACTGCTGTCAGAAAAATCATGAACTGTGGAGGTTTTGGCATGGAG
GCAACCTTACTCCTGGTGGTTGGCTTTTCGCATACCAAAGGGGTGGCTATCTCCTTTCTG
GTACTTGCTGTAGGATTTAGTGGCTTCGCTATTTCAGGTTTTAATGTCAACCACCTGGAC
ATTGCCCCACGCTATGCCAGCATTCTCATGGGGATCTCAAACGGAGTGGGAACCCTCTCT
GGAATGGTCTGTCCCCTCATTGTCGGTGCAATGACCAGGCACAAGACCCGTGAAGAATGG
CAGAATGTGTTCCTCATAGCTGCCCTGGTGCATTACAGTGGTGTGATCTTCTATGGGGTC
TTTGCTTCTGGGGAGAAACAGGAGTGGGCTGACCCAGAGAATCTCTCTGAGGAGAAATGT
GGAATCATTGACCAGGACGAATTAGCTGAGGAGATAGAACTCAACCATGAGAGTTTTGCG
AGTCCCAAAAAGAAGATGTCTTATGGAGCCACCTCCCAGAATTGTGAAGTCCAGAAGAAG
GAATGGAAAGGACAGAGAGGAGCGACCCTTGATGAGGAAGAGCTGACATCCTACCAGAAT
GAAGAGAGAAACTTCTCAACTATATCCTAA
Protein Properties
Number of Residues 589
Molecular Weight 59076.69
Theoretical pI 5.94
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Vesicular glutamate transporter 3
MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTTEEEDNIELNEEGRPVQTSRP
SPPLCDCHCCGLPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV
LVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSL
SKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPH
MVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEW
QNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEEIELNHESFA
SPKKKMSYGATSQNCEVQKKEWKGQRGATLDEEELTSYQNEERNFSTIS
GenBank ID Protein 21213895
UniProtKB/Swiss-Prot ID Q8NDX2
UniProtKB/Swiss-Prot Entry Name VGLU3_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ459241
GeneCard ID SLC17A8
GenAtlas ID SLC17A8
HGNC ID HGNC:20151
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Takamori S, Malherbe P, Broger C, Jahn R: Molecular cloning and functional characterization of human vesicular glutamate transporter 3. EMBO Rep. 2002 Aug;3(8):798-803. Epub 2002 Jul 15. [PubMed:12151341 ]
  4. Ruel J, Emery S, Nouvian R, Bersot T, Amilhon B, Van Rybroek JM, Rebillard G, Lenoir M, Eybalin M, Delprat B, Sivakumaran TA, Giros B, El Mestikawy S, Moser T, Smith RJ, Lesperance MM, Puel JL: Impairment of SLC17A8 encoding vesicular glutamate transporter-3, VGLUT3, underlies nonsyndromic deafness DFNA25 and inner hair cell dysfunction in null mice. Am J Hum Genet. 2008 Aug;83(2):278-92. doi: 10.1016/j.ajhg.2008.07.008. [PubMed:18674745 ]