You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP03979
Secondary Accession Numbers
  • 9567
Name Phosphatidylinositol 3-kinase regulatory subunit gamma
Synonyms
  1. PI3-kinase regulatory subunit gamma
  2. PI3-kinase subunit p55-gamma
  3. PI3K regulatory subunit gamma
  4. Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma
  5. PtdIns-3-kinase regulatory subunit gamma
  6. PtdIns-3-kinase regulatory subunit p55-gamma
  7. p55PIK
Gene Name PIK3R3
Protein Type Enzyme
Biological Properties
General Function Involved in phosphoinositide 3-kinase regulator activity
Specific Function Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
phosphoinositide 3-kinase complex
Function
binding
phosphoinositide 3-kinase regulator activity
enzyme regulator activity
protein binding
kinase regulator activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p34.1
SNPs PIK3R3
Gene Sequence
>1386 bp
ATGTACAATACGGTGTGGAGTATGGACCGCGATGACGCAGACTGGAGGGAGGTGATGATG
CCCTATTCGACAGAACTGATATTTTATATTGAAATGGATCCTCCAGCTCTTCCACCAAAG
CCACCTAAGCCAATGACTTCAGCAGTTCCAAATGGAATGAAGGACAGTTCTGTTTCTCTT
CAGGATGCAGAATGGTACTGGGGGGATATTTCAAGGGAGGAGGTAAATGACAAATTGCGG
GATATGCCAGATGGGACCTTCTTGGTCCGAGATGCCTCAACAAAAATGCAGGGAGATTAT
ACTTTGACTTTGCGGAAGGGAGGCAATAATAAGTTAATAAAGATCTATCACCGGGATGGT
AAATATGGCTTTTCTGATCCTCTGACATTTAATTCCGTGGTGGAGCTCATTAACCACTAT
CACCATGAATCTCTTGCTCAGTACAATCCCAAACTTGATGTGAAGCTGATGTACCCAGTG
TCCAGATACCAACAGGATCAGTTGGTAAAAGAAGATAATATTGATGCAGTAGGTAAAAAA
CTGCAAGAATACCACTCTCAGTATCAGGAGAAGAGTAAAGAGTATGATAGGCTGTATGAA
GAATATACTAGAACATCCCAGGAAATACAGATGAAGAGGACTGCAATAGAAGCTTTTAAT
GAAACAATTAAAATATTTGAAGAGCAGTGTCACACACAAGAACAACATAGCAAAGAATAT
ATTGAGCGATTTCGCAGAGAGGGGAATGAAAAGGAGATTGAACGAATTATGATGAATTAT
GATAAATTGAAATCACGTCTGGGTGAGATTCATGATAGCAAAATGCGTCTAGAGCAGGAT
TTGAAGAAACAAGCTTTGGACAACCGAGAAATAGATAAAAAAATGAATAGTATCAAACCT
GACCTGATCCAGCTGCGAAAGATCCGAGATCAACACCTTGTATGGCTCAATCACAAAGGA
GTGAGACAGAAACGCCTGAATGTCTGGCTGGGAATTAAGAATGAGGATGCTGATGAGAAC
TATTTTATCAATGAGGAAGATGAAAACCTGCCCCATTATGATGAGAAAACCTGGTTTGTT
GAGGATATCAATCGAGTACAAGCAGAGGACTTGCTTTATGGGAAACCTGATGGTGCATTC
TTAATTCGTGAGAGTAGCAAGAAAGGATGCTATGCTTGCTCTGTGGTGGCCGATGGGGAA
GTGAAGCACTGTGTGATCTACAGCACTGCTCGGGGCTATGGCTTTGCAGAGCCCTACAAC
CTGTACAGCTCTCTGAAGGAGCTAGTGCTCCATTACCAGCAGACATCCTTGGTTCAGCAC
AACGACTCCCTCAACGTCAGGCTTGCCTACCCTGTTCATGCACAGATGCCCTCGCTTTGC
AGATAA
Protein Properties
Number of Residues 461
Molecular Weight 54462.1
Theoretical pI 6.02
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphatidylinositol 3-kinase regulatory subunit gamma
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92569
UniProtKB/Swiss-Prot Entry Name P55G_HUMAN
PDB IDs
GenBank Gene ID D88532
GeneCard ID PIK3R3
GenAtlas ID PIK3R3
HGNC ID HGNC:8981
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Dey BR, Furlanetto RW, Nissley SP: Cloning of human p55 gamma, a regulatory subunit of phosphatidylinositol 3-kinase, by a yeast two-hybrid library screen with the insulin-like growth factor-I receptor. Gene. 1998 Mar 16;209(1-2):175-83. [PubMed:9524259 ]