Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04079
Secondary Accession Numbers
  • 9668
Name Phosphatidylinositol-5-phosphate 4-kinase type-2 gamma
Synonyms
  1. PI(5)P 4-kinase type II gamma
  2. PIP4KII-gamma
  3. Phosphatidylinositol-5-phosphate 4-kinase type II gamma
Gene Name PIP4K2C
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatidylinositol phosphate kinase activity
Specific Function May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphatidylinositol phosphate kinase activity
lipid kinase activity
Process
metabolic process
phosphatidylinositol metabolic process
organophosphate metabolic process
phospholipid metabolic process
glycerophospholipid metabolic process
phosphoinositide metabolic process
Cellular Location
  1. Cytoplasm
  2. Membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13.3
SNPs PIP4K2C
Gene Sequence
>1266 bp
ATGGCGTCCTCCTCGGTCCCACCAGCCACGGTATCGGCGGCGACAGCAGGCCCCGGCCCA
GGTTTCGGCTTCGCCTCCAAGACCAAGAAGAAGCATTTCGTGCAGCAGAAGGTGAAGGTG
TTCCGGGCGGCCGACCCGCTGGTGGGTGTGTTCCTGTGGGGCGTAGCCCACTCGATCAAT
GAGCTCAGCCAGGTGCCTCCCCCGGTGATGCTGCTGCCAGATGACTTTAAGGCCAGCTCC
AAGATCAAGGTCAACAATCACCTTTTCCACAGGGAAAATCTGCCCAGTCATTTCAAGTTC
AAGGAGTATTGTCCCCAGGTCTTCAGGAACCTCCGTGATCGATTTGGCATTGATGACCAA
GATTACTTGGTGTCCCTTACCCGAAACCCCCCCAGCGAAAGTGAAGGCAGTGATGGTCGC
TTCCTTATCTCCTACGATCGGACTCTGGTCATCAAAGAAGTATCCAGTGAGGACATTGCT
GACATGCATAGCAACCTCTCCAACTATCACCAGTACATTGTGAAGTGCCATGGCAACACG
CTTCTGCCCCAGTTCCTGGGGATGTACCGAGTCAGTGTGGACAACGAAGACAGCTACATG
CTTGTGATGCGCAATATGTTTAGCCACCGTCTTCCTGTGCACAGGAAGTATGACCTCAAG
GGTTCCCTAGTGTCCCGGGAAGCCAGCGATAAGGAAAAGGTTAAAGAATTGCCCACCCTT
AAGGATATGGACTTTCTCAACAAGAACCAGAAAGTATATATTGGTGAAGAGGAGAAGAAA
ATATTTCTGGAGAAGCTGAAGAGAGATGTGGAGTTTCTAGTGCAGCTGAAGATCATGGAC
TACAGCCTTCTGCTAGGCATCCACGACATCATTCGGGGCTCTGAACCAGAGGAGGAAGCG
CCCGTGCGGGAGGATGAGTCAGAGGTGGATGGGGACTGCAGCCTGACTGGACCTCCTGCT
CTGGTGGGCTCCTATGGCACCTCCCCAGAGGGTATCGGAGGCTACATCCATTCCCATCGG
CCCCTGGGCCCAGGAGAGTTTGAGTCCTTCATTGATGTCTATGCCATCCGGAGTGCTGAA
GGAGCCCCCCAGAAGGAGGTCTACTTCATGGGCCTCATTGATATCCTTACACAGTATGAT
GCCAAGAAGAAAGCAGCTCATGCAGCCAAAACTGTCAAGCATGGGGCTGGGGCAGAGATC
TCTACTGTCCATCCGGAGCAGTATGCTAAGCGATTCCTGGATTTTATTACCAACATCTTT
GCCTAA
Protein Properties
Number of Residues 421
Molecular Weight 47285.5
Theoretical pI 6.84
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Phosphatidylinositol-5-phosphate 4-kinase type-2 gamma
MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
ELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEG
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A
GenBank ID Protein 226371739
UniProtKB/Swiss-Prot ID Q8TBX8
UniProtKB/Swiss-Prot Entry Name PI42C_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001146258.1
GeneCard ID PIP4K2C
GenAtlas ID PIP4K2C
HGNC ID HGNC:23786
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]