You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04109
Secondary Accession Numbers
  • 9698
Name Acetoacetyl-CoA synthetase
Synonyms
  1. Acyl-CoA synthetase family member 1
  2. Protein sur-5 homolog
Gene Name AACS
Protein Type Enzyme
Biological Properties
General Function Involved in acetoacetate-CoA ligase activity
Specific Function Activates acetoacetate to acetoacetyl-CoA. May be involved in utilizing ketone body for the fatty acid-synthesis during adipose tissue development (By similarity).
Pathways
  • Butanoate metabolism
Reactions
Adenosine triphosphate + Acetoacetic acid + Coenzyme A → Adenosine monophosphate + Pyrophosphate + Acetoacetyl-CoA details
GO Classification
Biological Process
adipose tissue development
cellular response to cholesterol
cellular response to glucose stimulus
cellular response to testosterone stimulus
fatty acid metabolic process
liver development
positive regulation of insulin secretion
response to drug
response to ethanol
response to nutrient
response to oleic acid
response to purine-containing compound
response to starvation
white fat cell differentiation
Cellular Component
cytosol
Function
catalytic activity
ligase activity
ligase activity, forming carbon-sulfur bonds
acid-thiol ligase activity
acetoacetate-coa ligase activity
Molecular Function
acetoacetate-CoA ligase activity
ATP binding
butyrate-CoA ligase activity
Process
metabolic process
primary metabolic process
lipid metabolic process
Cellular Location
  1. Cytoplasm
  2. cytosol
Gene Properties
Chromosome Location 12
Locus 12q24.31
SNPs AACS
Gene Sequence
>2019 bp
ATGTCCAAGGAGGAGCGCCCCGGTCGGGAGGAGATCCTGGAGTGCCAGGTGATGTGGGAG
CCTGACAGTAAGAAGAACACGCAGATGGACCGCTTCCGGGCGGCTGTGGGCGCCGCCTGC
GGCCTGGCGCTGGAGAGTTATGATGACTTGTACCATTGGTCCGTTGAGTCATATTCAGAC
TTCTGGGCAGAGTTCTGGAAATTCAGTGGAATTGTCTTCTCACGTGTGTATGATGAGGTT
GTGGACACATCGAAAGGAATCGCAGATGTCCCCGAGTGGTTCAAAGGCAGTCGGCTCAAC
TATGCAGAAAACCTCCTGCGGCACAAAGAGAATGACAGAGTTGCCCTTTACATTGCAAGG
GAAGGCAAAGAGGAAATTGTGAAGGTGACTTTTGAAGAGCTGAGGCAAGAAGTGGCTTTG
TTTGCAGCAGCAATGAGGAAAATGGGTGTGAAGAAAGGAGATCGGGTTGTTGGTTATTTA
CCCAACAGTGAGCACGCTGTCGAGGCGATGCTGGCTGCGGCAAGCATTGGTGCCATCTGG
AGCTCCACGTCCCCGGACTTCGGTGTGAATGGTGTGCTGGACCGGTTTTCTCAAATTCAG
CCAAAGCTCATCTTCTCTGTGGAGGCTGTTGTCTATAATGGCAAAGAGCACAACCACATG
GAAAAGCTGCAGCAGGTGGTTAAAGGCCTACCAGACTTGAAGAAAGTGGTGGTGATTCCT
TATGTGTCCTCCAGAGAGAACATAGACCTTTCAAAGATTCCAAACAGTGTGTTTCTGGAT
GACTTTCTTGCCACCGGCACCAGTGAGCAGGCCCCGCAGCTGGAGTTCGAGCAGCTGCCC
TTCAGCCACCCACTGTTCATCATGTTCTCATCGGGCACCACGGGCGCACCCAAGTGCATG
GTGCATTCCGCTGGGGGCACCCTCATCCAGCATCTGAAGGAGCACCTGCTGCACGGCAAC
ATGACCAGCAGTGACATCCTCCTGTGCTACACCACGGTCGGCTGGATGATGTGGAACTGG
ATGGTGTCCCTTCTGGCCACAGGAGCGGCCATGGTCTTGTACGATGGCTCCCCCCTGGTG
CCCACGCCCAATGTGCTCTGGGACCTGGTTGACAGGATAGGCATCACTGTCCTGGTAACT
GGGGCCAAGTGGCTGTCAGTGCTGGAAGAGAAGGCCATGAAGCCGGTGGAAACCCACAGT
CTCCAGATGCTCCACACGATCCTGTCCACTGGCTCCCCACTGAAAGCCCAGAGCTACGAG
TATGTCTACAGGTGCATCAAGAGCAGCATCCTCCTGGGCTCCATCTCAGGAGGCACCGAC
ATCATCTCCTGCTTCATGGGCCACAATTTTTCTCTTCCTGTGTATAAAGGGGAGATTCAG
GCCCGGAACCTGGGCATGGCCGTGGAAGCGTGGAACGAGGAAGGAAAGGCGGTCTGGGGA
GAGAGCGGCGAGCTGGTGTGTACTAAGCCGATCCCTTGCCAGCCCACACACTTCTGGAAC
GATGAGAACGGCAACAAGTACAGGAAGGCGTATTTCTCCAAATTCCCAGGTATCTGGGCT
CATGGCGACTACTGCAGAATCAACCCCAAGACCGGGGGCATCGTCATGCTTGGCCGGAGT
GACGGCACCCTCAACCCCAACGGGGTGCGGTTCGGCAGCTCGGAAATCTATAACATTGTG
GAATCCTTCGAGGAGGTGGAGGACAGCCTGTGTGTCCCCCAGTATAACAAGTACAGGGAG
GAGAGGGTGATCCTCTTCCTGAAGATGGCCTCCGGGCACGCCTTCCAGCCTGACTTGGTT
AAGAGGATCCGTGACGCCATCCGCATGGGCTTGTCTGCGCGACACGTGCCCAGCCTCATC
CTGGAAACCAAGGGCATCCCGTATACGCTCAACGGCAAGAAAGTGGAAGTTGCCGTCAAA
CAGATCATCGCTGGAAAAGCCGTGGAGCAAGGAGGTGCTTTCTCGAACCCCGAGACCCTG
GATCTGTACCGGGACATCCCTGAGCTGCAGGGCTTCTGA
Protein Properties
Number of Residues 672
Molecular Weight 75143.645
Theoretical pI 6.244
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Acetoacetyl-CoA synthetase
MSKEERPGREEILECQVMWEPDSKKNTQMDRFRAAVGAACGLALESYDDLYHWSVESYSD
FWAEFWKFSGIVFSRVYDEVVDTSKGIADVPEWFKGSRLNYAENLLRHKENDRVALYIAR
EGKEEIVKVTFEELRQEVALFAAAMRKMGVKKGDRVVGYLPNSEHAVEAMLAAASIGAIW
SSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVIP
YVSSRENIDLSKIPNSVFLDDFLATGTSEQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCM
VHSAGGTLIQHLKEHLLHGNMTSSDILLCYTTVGWMMWNWMVSLLATGAAMVLYDGSPLV
PTPNVLWDLVDRIGITVLVTGAKWLSVLEEKAMKPVETHSLQMLHTILSTGSPLKAQSYE
YVYRCIKSSILLGSISGGTDIISCFMGHNFSLPVYKGEIQARNLGMAVEAWNEEGKAVWG
ESGELVCTKPIPCQPTHFWNDENGNKYRKAYFSKFPGIWAHGDYCRINPKTGGIVMLGRS
DGTLNPNGVRFGSSEIYNIVESFEEVEDSLCVPQYNKYREERVILFLKMASGHAFQPDLV
KRIRDAIRMGLSARHVPSLILETKGIPYTLNGKKVEVAVKQIIAGKAVEQGGAFSNPETL
DLYRDIPELQGF
GenBank ID Protein 48290356
UniProtKB/Swiss-Prot ID Q86V21
UniProtKB/Swiss-Prot Entry Name AACS_HUMAN
PDB IDs Not Available
GenBank Gene ID AB054121
GeneCard ID AACS
GenAtlas ID AACS
HGNC ID HGNC:21298
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Ohgami M, Takahashi N, Yamasaki M, Fukui T: Expression of acetoacetyl-CoA synthetase, a novel cytosolic ketone body-utilizing enzyme, in human brain. Biochem Pharmacol. 2003 Mar 15;65(6):989-94. [PubMed:12623130 ]
  5. Gu T, Orita S, Han M: Caenorhabditis elegans SUR-5, a novel but conserved protein, negatively regulates LET-60 Ras activity during vulval induction. Mol Cell Biol. 1998 Aug;18(8):4556-64. [PubMed:9671465 ]
  6. Watkins PA, Maiguel D, Jia Z, Pevsner J: Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome. J Lipid Res. 2007 Dec;48(12):2736-50. Epub 2007 Aug 30. [PubMed:17762044 ]