You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04232
Secondary Accession Numbers
  • 9821
Name Diacylglycerol kinase eta
Synonyms
  1. DAG kinase eta
  2. DGK-eta
  3. Diglyceride kinase eta
Gene Name DGKH
Protein Type Unknown
Biological Properties
General Function Involved in diacylglycerol kinase activity
Specific Function Phosphorylates diacylglycerol (DAG) to generate phosphatidic acid (PA)
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
diacylglycerol kinase activity
Process
intracellular signaling pathway
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
activation of protein kinase c activity by g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 13q14.11
SNPs DGKH
Gene Sequence
>3663 bp
ATGGCAGGGGCCGGAGGCCAGCACCACCCTCCGGGCGCCGCTGGAGGAGCGGCCGCCGGA
GCCGGCGCCGCGGTCACCTCCGCCGCTGCCTCGGCGGGGCCGGGAGAGGATTCGTCTGAC
AGCGAAGCGGAGCAAGAGGGACCCCAGAAACTGATCCGCAAAGTGTCTACCTCGGGGCAG
ATCCGGACCAAGACCAGTATTAAAGAGGGACAGCTATTGAAGCAAACCAGTTCTTTCCAA
AGGTGGAAAAAGCGATACTTCAAACTTCGAGGCCGCACCCTTTACTATGCAAAGGACTCA
AAGTCTCTGATATTTGATGAAGTTGACCTCTCAGATGCTAGTGTAGCTGAAGCAAGCACG
AAAAATGCTAACAACAGCTTCACGATCATCACTCCATTCAGAAGGCTAATGCTGTGTGCT
GAGAACAGAAAGGAGATGGAGGATTGGATCAGCTCACTGAAGTCTGTACAGACCAGAGAA
CCCTACGAGGTGGCCCAGTTTAATGTGGAACATTTCTCAGGGATGCACAACTGGTACGCC
TGCTCCCACGCCCGACCCACCTTCTGTAACGTGTGCAGAGAGAGTCTTTCTGGAGTCACC
TCCCATGGCCTGTCCTGCGAAGTGTGTAAATTCAAGGCTCACAAAAGATGTGCAGTGAGA
GCAACAAATAACTGTAAATGGACTACCCTGGCCTCCATCGGGAAGGACATTATAGAAGAT
GAAGATGGCGTCGCGATGCCTCACCAGTGGCTTGAGGGCAACCTGCCTGTAAGTGCCAAG
TGTGCTGTCTGCGACAAAACATGTGGCAGTGTTCTCCGTCTACAGGATTGGAAATGCCTT
TGGTGTAAGACAATGGTACACACTGCCTGCAAAGATTTATACCATCCAATATGTCCACTT
GGTCAATGTAAAGTATCTATCATACCTCCAATTGCACTAAACAGCACCGATTCCGATGGT
TTCTGTAGAGCAACATTTTCGTTCTGTGTTAGTCCTCTATTGGTTTTTGTCAATTCTAAG
AGTGGAGATAATCAGGGAGTAAAGTTCCTCCGTCGCTTTAAACAGTTGCTAAATCCGGCT
CAGGTGTTTGATTTAATGAATGGAGGTCCTCATTTAGGTTTAAGATTATTTCAGAAGTTT
GACAATTTCCGGATTCTTGTTTGTGGAGGCGATGGAAGTGTAGGTTGGGTTTTGTCAGAA
ATCGATAAGCTCAACTTGAATAAACAGTGTCAGCTGGGAGTGTTGCCTTTGGGTACAGGA
AATGACCTTGCCCGAGTTCTTGGCTGGGGAGGTTCATATGACGATGACACCCAACTTCCT
CAGATCCTAGAGAAACTGGAACGAGCCAGTACCAAAATGTTGGACAGGTGGAGTATAATG
ACATATGAACTCAAATTGCCACCAAAAGCTTCCCTACTTCCAGGACCTCCAGAAGCATCT
GAAGAATTTTATATGACGATTTATGAAGACTCAGTTGCAACGCATCTTACAAAAATCCTC
AATTCTGATGAACATGCAGTGGTCATATCTTCTGCCAAGACGCTATGTGAAACTGTAAAG
GACTTCGTTGCCAAAGTAGAAAAGACGTATGACAAAACCTTGGAAAATGCCGTTGTAGCT
GATGCCGTGGCCAGTAAATGTTCAGTCCTAAACGAGAAGCTCGAACAACTGCTGCAGGCT
TTGCACACAGATTCCCAGGCTGCGCCTGTTCTCCCTGGCCTCAGCCCTCTCATTGTGGAA
GAAGATGCTGTGGAATCGTCCAGTGAAGAGTCCCTGGGTGAAAGCAAAGAGCAGCTTGGG
GATGACGTTACAAAACCTTCCTCCCAGAAAGCCGTCAAACCAAGGGAAATCATGTTGCGG
GCAAATAGTTTAAAGAAAGCAGTGAGGCAAGTCATTGAGGAAGCCGGAAAAGTTATGGAT
GACCCGACAGTTCACCCCTGTGAACCAGCTAATCAGTCCTCTGATTATGACAGCACAGAA
ACAGATGAATCTAAGGAGGAAGCTAAAGATGATGGTGCCAAAGAATCAATAACTGTTAAA
ACTGCACCTCGGTCTCCAGATGCCCGGGCAAGTTATGGCCATTCCCAAACTGATTCTGTC
CCTGGTCCAGCTGTGGCAGCCAGCAAAGAAAACCTCCCTGTGCTCAATACCAGAATAATC
TGCCCAGGTTTAAGAGCAGGACTGGCTGCCTCAATTGCTGGGAGTTCGATTATCAACAAA
ATGTTACTGGCAAACATTGATCCTTTTGGTGCCACGCCGTTTATTGACCCGGATCTAGAT
TCCGTAGATGGATATTCAGAAAAATGTGTCATGAACAATTACTTTGGGATTGGATTAGAT
GCAAAAATTTCATTAGAATTTAATAATAAAAGAGAGGAGCACCCTGAAAAATGCAGGAGC
CGAACTAAAAACTTGATGTGGTATGGAGTCCTTGGAACCCGGGAGTTATTACAGAGATCG
TACAAGAATTTAGAACAAAGGGTTCAACTTGAGTGTGATGGGCAGTATATTCCTCTTCCC
AGCTTGCAAGGCATAGCCGTGTTGAACATTCCCAGCTATGCTGGAGGCACTAACTTTTGG
GGTGGAACTAAAGAGGATGATATATTTGCTGCACCATCCTTTGATGACAAGATCCTGGAA
GTTGTAGCAATATTTGATAGCATGCAAATGGCAGTTTCAAGGGTCATTAAACTGCAGCAT
CATCGAATAGCCCAGTGCCGTACAGTGAAAATCACTATATTTGGTGACGAAGGAGTCCCA
GTGCAAGTGGATGGTGAAGCGTGGGTTCAGCCTCCAGGGATTATCAAAATTGTGCACAAA
AACAGAGCACAAATGCTAACAAGGGACAGAGCCTTTGAGAGCACTCTGAAATCTTGGGAA
GATAAGCAGAAGTGTGATTCTGGTAAACCAGTTCTCCGAACCCATTTGTACATCCATCAC
GCCATTGACTTGGCAACAGAAGAGGTGTCGCAGATGCAGCTATGCTCCCAGGCTGCAGAG
GAGCTCATTACTAGGATATGTGACGCAGCCACAATTCACTGTCTTTTGGAGCAAGAACTG
GCCCATGCTGTGAATGCCTGCTCCCATGCCCTGAATAAAGCCAACCCAAGGTGCCCGGAG
AGTCTTACAAGAGACACTGCCACTGAAATAGCCATCAATGTGAAGGCGCTGTATAATGAA
ACAGAATCTTTGCTAGTTGGCAGGGTTCCTTTGCAGCTGGAATCGCCACATGAAGAGCGA
GTATCCAATGCCTTACACTCTGTGGAGGTGGAATTACAGAAACTGACAGAGATTCCTTGG
CTTTATTATATCTTACACCCAAATGAGGATGAGGAACCTCCTATGGATTGCACCAAAAGG
AACAACAGAAGCACCGTATTTCGAATAGTGCCAAAGTTTAAAAAGGAAAAGGTTCAGAAG
CAGAAGACAAGTTCACAGCCTGTTCAGAAATGGGGCACAGAGGAAGTTGCTGCTTGGCTG
GATCTGCTCAATTTGGGAGAGTACAAAGATATCTTCATCCGTCATGACATCAGAGGGGCT
GAACTTTTGCATCTGGAAAGGCGAGATCTTAAGGATCTGGGGATACCGAAAGTGGGTCAT
GTGAAGCGAATTCTCCAGGGAATTAAAGAGCTTGGAAGGAGCACTCCACAGTCGGAGGTG
TAA
Protein Properties
Number of Residues 1220
Molecular Weight 134864.3
Theoretical pI 6.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Diacylglycerol kinase eta
MAGAGGQHHPPGAAGGAAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIED
EDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
GQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAS
EEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVA
DAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLG
DDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTE
TDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLNTRII
CPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSVDGYSEKCVMNNYFGIGLD
AKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQH
HRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWE
DKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQEL
AHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEER
VSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQK
QKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDLKDLGIPKVGH
VKRILQGIKELGRSTPQSEV
GenBank ID Protein 29788751
UniProtKB/Swiss-Prot ID Q86XP1
UniProtKB/Swiss-Prot Entry Name DGKH_HUMAN
PDB IDs
GenBank Gene ID NM_178009.2
GeneCard ID DGKH
GenAtlas ID DGKH
HGNC ID HGNC:2854
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  5. Murakami T, Sakane F, Imai S, Houkin K, Kanoh H: Identification and characterization of two splice variants of human diacylglycerol kinase eta. J Biol Chem. 2003 Sep 5;278(36):34364-72. Epub 2003 Jun 16. [PubMed:12810723 ]