You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04379
Secondary Accession Numbers
  • 9969
Name Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
Synonyms
  1. cAMP and cGMP phosphodiesterase 11A
Gene Name PDE11A
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides cAMP and cGMP. Catalyzes the hydrolysis of both cAMP and cGMP to 5'-AMP and 5'-GMP, respectively.
Pathways
  • Morphine addiction
  • Purine metabolism
Reactions
Guanosine 3',5'-cyclic phosphate + Water → Guanosine monophosphate details
Adenosine 3',5'-cyclic phosphate + Water → Adenosine monophosphate details
Cyclic AMP + Water → Adenosine monophosphate details
Cyclic GMP + Water → Guanosine monophosphate details
GO Classification
Biological Process
signal transduction
blood coagulation
cAMP catabolic process
cGMP catabolic process
Cellular Component
cytosol
perikaryon
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
cyclic-nucleotide phosphodiesterase activity
3',5'-cyclic-nucleotide phosphodiesterase activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
Molecular Function
metal ion binding
cAMP binding
cGMP-stimulated cyclic-nucleotide phosphodiesterase activity
3',5'-cyclic-GMP phosphodiesterase activity
cGMP binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Cytoplasm
  2. cytosol
Gene Properties
Chromosome Location 2
Locus 2q31.2
SNPs PDE11A
Gene Sequence
>2802 bp
ATGGCAGCCTCCCGCCTGGACTTTGGGGAGGTGGAAACTTTCCTGGACAGGCACCCAGAG
TTGTTTGAAGATTACTTGATGCGGAAGGGGAAGCAGGAGATGGTTGAAAAGTGGCTGCAG
AGGCACAGTCAGGGTCAGGGGGCTTTAGGTCCAAGGCCCTCTTTGGCTGGTACCAGCAGC
TTGGCTCACAGCACCTGCAGAGGTGGCAGCAGCGTTGGTGGTGGCACTGGACCAAATGGC
TCTGCCCACAGCCAGCCCCTTCCCGGTGGCGGGGACTGTGGTGGGGTTCCCTTGAGTCCC
AGCTGGGCCGGTGGCAGCAGGGGCGATGGGAACCTGCAGCGGAGAGCTTCTCAGAAAGAG
CTAAGGAAGAGTTTTGCCCGCTCCAAGGCCATCCACGTGAACAGGACCTACGATGAACAG
GTGACCTCCCGGGCTCAGGAACCCCTGAGTAGTGTACGACGGAGGGCACTTCTCCGGAAG
GCAAGCTCCCTGCCCCCCACCACAGCCCATATTCTCAGTGCGCTGCTGGAATCGAGAGTG
AATCTGCCTCGGTATCCCCCTACAGCCATCGACTACAAGTGCCATCTGAAAAAGCATAAT
GAGCGTCAGTTCTTTCTGGAATTGGTCAAAGATATCTCCAATGACCTTGACCTCACCAGC
CTGAGCTACAAGATTCTCATCTTTGTCTGCCTTATGGTGGATGCTGACCGCTGCTCTCTT
TTCCTGGTGGAAGGGGCAGCTGCTGGCAAGAAGACCTTGGTCTCCAAATTCTTTGATGTG
CATGCAGGAACACCTCTGCTGCCTTGCAGCAGCACAGAGAACTCAAATGAGGTGCAGGTC
CCCTGGGGCAAAGGTATCATTGGCTATGTCGGGGAGCATGGAGAAACGGTCAACATTCCT
GATGCCTACCAGGATCGACGATTCAATGATGAAATCGACAAGCTAACTGGATACAAGACA
AAATCATTATTGTGCATGCCTATCCGAAGCAGTGATGGTGAGATTATTGGTGTGGCCCAA
GCGATAAATAAGATTCCTGAAGGAGCTCCATTTACTGAAGATGATGAAAAAGTTATGCAG
ATGTATCTTCCATTTTGTGGAATCGCCATATCTAACGCTCAGCTCTTTGCTGCCTCAAGG
AAAGAATATGAAAGAAGCAGAGCTTTGCTAGAGGTGGTTAATGACCTCTTTGAAGAACAG
ACTGACCTGGAGAAAATTGTCAAGAAAATAATGCATCGGGCCCAAACTCTGCTGAAATGT
GAACGCTGTTCTGTTTTACTCCTAGAGGACATCGAATCACCAGTGGTGAAATTTACCAAA
TCCTTTGAATTGATGTCCCCAAAGTGCAGTGCTGATGCTGAGAACAGTTTCAAAGAAAGC
ATGGAGAAATCATCATACTCCGACTGGCTAATAAATAACAGCATTGCTGAGCTGGTTGCT
TCAACAGGCCTTCCAGTGAACATCAGTGATGCCTACCAGGATCCGCGCTTTGATGCAGAG
GCAGACCAGATATCTGGTTTTCACATAAGATCTGTTCTTTGTGTCCCTATTTGGAATAGC
AACCACCAAATAATTGGAGTGGCTCAAGTGTTAAACAGACTTGATGGGAAACCTTTTGAT
GATGCAGATCAACGACTTTTTGAGGCTTTTGTCATCTTTTGTGGACTTGGCATCAACAAC
ACAATTATGTATGATCAAGTGAAGAAGTCCTGGGCCAAGCAGTCTGTGGCTCTTGATGTG
CTATCATACCATGCAACATGTTCAAAAGCTGAAGTTGACAAGTTTAAGGCAGCCAACATC
CCTCTGGTGTCAGAACTTGCCATCGATGACATTCATTTTGATGACTTTTCTCTCGACGTT
GATGCCATGATCACAGCTGCTCTCCGGATGTTCATGGAGCTGGGGATGGTACAGAAATTT
AAAATTGACTATGAGACACTGTGTAGGTGGCTTTTGACAGTGAGGAAAAACTATCGGATG
GTTCTATACCACAACTGGAGACATGCCTTCAACGTGTGTCAGCTGATGTTCGCGATGTTA
ACCACTGCTGGGTTTCAAGACATTCTGACCGAGGTGGAAATTTTAGCGGTGATTGTGGGA
TGCCTGTGTCATGACCTCGACCACAGGGGAACCAACAATGCCTTCCAAGCTAAGAGTGGC
TCTGCCCTGGCCCAACTCTATGGAACCTCTGCTACCTTGGAGCATCACCATTTCAACCAC
GCCGTGATGATCCTTCAAAGTGAGGGTCACAATATCTTTGCTAACCTGTCCTCCAAGGAA
TATAGTGACCTTATGCAGCTTTTGAAGCAGTCAATATTGGCAACAGACCTCACGCTGTAC
TTTGAGAGGAGAACTGAATTCTTTGAACTTGTCAGTAAAGGAGAATACGATTGGAACATC
AAAAACCATCGTGATATATTTCGATCAATGTTAATGACAGCCTGTGACCTTGGAGCCGTG
ACCAAACCGTGGGAGATCTCCAGACAGGTGGCAGAACTTGTAACCAGTGAGTTCTTCGAA
CAAGGAGATCGGGAGAGATTAGAGCTCAAACTCACTCCTTCAGCAATTTTTGATCGGAAC
CGGAAGGATGAACTGCCTCGGTTGCAACTGGAGTGGATTGATAGCATCTGCATGCCTTTG
TATCAGGCACTGGTGAAGGTCAACGTGAAACTGAAGCCGATGCTAGATTCAGTAGCTACA
AACAGAAGTAAGTGGGAAGAGCTACACCAAAAACGACTGCTGGCCTCAACTGCCTCATCC
TCCCCTGCCAGTGTTATGGTAGCCAAGGAAGACAGGAACTAA
Protein Properties
Number of Residues 933
Molecular Weight 55699.16
Theoretical pI 5.892
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPRYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAT
NRSKWEELHQKRLLASTASSSPASVMVAKEDRN
GenBank ID Protein 116536085
UniProtKB/Swiss-Prot ID Q9HCR9
UniProtKB/Swiss-Prot Entry Name PDE11_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_016953.3
GeneCard ID PDE11A
GenAtlas ID PDE11A
HGNC ID HGNC:8773
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gross-Langenhoff M, Hofbauer K, Weber J, Schultz A, Schultz JE: cAMP is a ligand for the tandem GAF domain of human phosphodiesterase 10 and cGMP for the tandem GAF domain of phosphodiesterase 11. J Biol Chem. 2006 Feb 3;281(5):2841-6. Epub 2005 Dec 5. [PubMed:16330539 ]
  4. Yuasa K, Kotera J, Fujishige K, Michibata H, Sasaki T, Omori K: Isolation and characterization of two novel phosphodiesterase PDE11A variants showing unique structure and tissue-specific expression. J Biol Chem. 2000 Oct 6;275(40):31469-79. [PubMed:10906126 ]
  5. Fawcett L, Baxendale R, Stacey P, McGrouther C, Harrow I, Soderling S, Hetman J, Beavo JA, Phillips SC: Molecular cloning and characterization of a distinct human phosphodiesterase gene family: PDE11A. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3702-7. [PubMed:10725373 ]
  6. Hetman JM, Robas N, Baxendale R, Fidock M, Phillips SC, Soderling SH, Beavo JA: Cloning and characterization of two splice variants of human phosphodiesterase 11A. Proc Natl Acad Sci U S A. 2000 Nov 7;97(23):12891-5. [PubMed:11050148 ]
  7. Yuasa K, Kanoh Y, Okumura K, Omori K: Genomic organization of the human phosphodiesterase PDE11A gene. Evolutionary relatedness with other PDEs containing GAF domains. Eur J Biochem. 2001 Jan;268(1):168-78. [PubMed:11121118 ]
  8. Loughney K, Taylor J, Florio VA: 3',5'-cyclic nucleotide phosphodiesterase 11A: localization in human tissues. Int J Impot Res. 2005 Jul-Aug;17(4):320-5. [PubMed:15800651 ]
  9. Francis SH: Phosphodiesterase 11 (PDE11): is it a player in human testicular function? Int J Impot Res. 2005 Sep-Oct;17(5):467-8. [PubMed:16079899 ]
  10. Horvath A, Boikos S, Giatzakis C, Robinson-White A, Groussin L, Griffin KJ, Stein E, Levine E, Delimpasi G, Hsiao HP, Keil M, Heyerdahl S, Matyakhina L, Libe R, Fratticci A, Kirschner LS, Cramer K, Gaillard RC, Bertagna X, Carney JA, Bertherat J, Bossis I, Stratakis CA: A genome-wide scan identifies mutations in the gene encoding phosphodiesterase 11A4 (PDE11A) in individuals with adrenocortical hyperplasia. Nat Genet. 2006 Jul;38(7):794-800. Epub 2006 Jun 11. [PubMed:16767104 ]