You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04436
Secondary Accession Numbers
  • 10027
Name Phosphoglycolate phosphatase
Synonyms
  1. PGP
  2. PGPase
Gene Name PGP
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways
  • Glyoxylate and dicarboxylate metabolism
Reactions
Phosphoglycolic acid + Water → Glycolic acid + Phosphate details
GO Classification
Biological Process
carbohydrate metabolic process
dephosphorylation
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
phosphoglycolate phosphatase activity
Process
metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 16
Locus 16p13.3
SNPs PGP
Gene Sequence
>966 bp
ATGGCGGCGGCGGAGGCCGGTGGCGACGACGCCCGCTGCGTGCGGCTGAGCGCCGAGCGG
GCACAGGCGCTGCTGGCCGACGTGGACACGCTGCTGTTCGACTGCGACGGCGTGCTGTGG
CGCGGGGAGACCGCCGTGCCTGGCGCGCCCGAGGCCCTGCGGGCGCTGCGAGCCCGCGGC
AAGCGCCTGGGCTTCATCACCAACAACAGCAGCAAGACCCGCGCTGCCTACGCCGAGAAG
CTGCGGCGCCTGGGCTTCGGCGGCCCCGCGGGGCCCGGCGCCAGCCTGGAGGTCTTCGGC
ACGGCCTACTGCACCGCGCTCTACCTGCGCCAGCGCCTGGCCGGCGCCCCCGCGCCCAAG
GCCTACGTGCTGGGCAGCCCAGCCCTGGCCGCGGAGCTGGAGGCCGTGGGCGTCGCCAGC
GTGGGCGTGGGGCCCGAGCCACTGCAGGGCGAGGGTCCCGGCGACTGGCTGCACGCGCCG
CTGGAGCCCGACGTGCGCGCGGTGGTGGTGGGCTTTGACCCGCACTTCAGCTACATGAAG
CTCACCAAGGCCCTGCGCTACCTGCAGCAGCCCGGCTGCCTGCTCGTGGGCACCAACATG
GACAACCGGCTTCCGCTTGAGAACGGCCGCTTCATCGCGGGTACCGGGTGTCTGGTCCGA
GCCGTGGAGATGGCCGCCCAGCGCCAGGCCGACATCATCGGGAAGCCCAGCCGCTTCATT
TTCGACTGCGTGTCCCAGGAATACGGCATCAACCCCGAGCGCACCGTCATGGTGGGAGAC
CGCCTGGACACAGACATCCTCCTAGGCGCCACCTGTGGCCTGAAGACCATCCTGACCCTC
ACCGGAGTCTCCACTCTAGGGGATGTGAAGAATAATCAGGAAAGTGACTGCGTGTCTAAG
AAGAAAATGGTCCCTGACTTCTATGTTGACAGCATAGCCGACCTTTTGCCTGCCCTTCAA
GGTTAA
Protein Properties
Number of Residues 321
Molecular Weight 34005.69
Theoretical pI 6.134
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Phosphoglycolate phosphatase
MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARG
KRLGFITNNSSKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPK
AYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMK
LTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFI
FDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSK
KKMVPDFYVDSIADLLPALQG
GenBank ID Protein 108796653
UniProtKB/Swiss-Prot ID A6NDG6
UniProtKB/Swiss-Prot Entry Name PGP_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001042371.2
GeneCard ID PGP
GenAtlas ID PGP
HGNC ID HGNC:8909
References
General References
  1. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  2. Barker RF, Hopkinson DA: Genetic polymorphism of human phosphoglycolate phosphatase (PGP). Ann Hum Genet. 1978 Oct;42(2):143-51. [PubMed:215071 ]