You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04453
Secondary Accession Numbers
  • 10045
Name PI-PLC X domain-containing protein 2
Synonyms Not Available
Gene Name PLCXD2
Protein Type Enzyme
Biological Properties
General Function Involved in phosphoric diester hydrolase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
phospholipase c activity
lipase activity
phospholipase activity
Process
metabolic process
primary metabolic process
lipid metabolic process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:3
Locus 3q13.2
SNPs PLCXD2
Gene Sequence
>918 bp
ATGCTAGCAGTTAGGAAGGCCAGGAGGAAACTCAGGATGGGGACCATCTGCTCCCCCAAC
CCCAGCGGGACAAAGACATCATCGGAGGTCTGCAATGCCGACTGGATGGCCTCGCTCCCC
CCTCACCTCCACAACCTCCCCCTTTCCAATCTGGCAATCCCAGGCTCACATGATTCATTC
AGCTACTGGGTGGATGAAAAGTCCCCAGTGGGGCCTGACCAAACCCAAGCTATCAAACGC
CTCGCCAGGATCTCCTTGGTGAAGAAGCTAATGAAGAAGTGGTCTGTGACTCAGAACCTG
ACATTTCGAGAACAGCTGGAAGCTGGGATCCGCTACTTTGACCTGCGTGTGTCTTCCAAA
CCAGGGGATGCCGACCAGGAGATCTACTTCATCCATGGGCTTTTTGGCATCAAGGTCTGG
GATGGGCTGATGGAAATTGACTCGTTTCTTACACAGCACCCCCAGGAGATTATCTTCCTG
GATTTCAACCACTTCTATGCCATGGATGAGACCCATCACAAATGCCTGGTTCTGCGGATC
CAGGAGGCCTTTGGAAACAAGCTGTGCCCAGCCTGCAGTGTGGAAAGTTTGACGCTGCGA
ACTCTGTGGGAGAAGAACTGCCAGGTTCTTATTTTCTACCACTGTCCCTTCTACAAGCAG
TACCCCTTCCTGTGGCCAGGAAAGAAGATTCCAGCGCCCTGGGCAAACACCACAAGTGTG
CGCAAACTAATCCTCTTCTTGGAGACCACTCTGAGTGAGCGGGCCTCACGGGGCTCCTTC
CATGTCTCCCAAGCGATCCTCACCCCCAGAGTGAAGACCATTGCCCGGGGCTTGGTTGGG
GGCCTCAAGAACACGCTGGTTCATAGCAATCGCTGGAACAGCCATGGGCCATCCCTGCTG
AGTCAGGAAAGAAGCTGA
Protein Properties
Number of Residues 305
Molecular Weight 34776.9
Theoretical pI 9.94
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>PI-PLC X domain-containing protein 2
MLAVRKARRKLRMGTICSPNPSGTKTSSEVCNADWMASLPPHLHNLPLSNLAIPGSHDSF
SYWVDEKSPVGPDQTQAIKRLARISLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSK
PGDADQEIYFIHGLFGIKVWDGLMEIDSFLTQHPQEIIFLDFNHFYAMDETHHKCLVLRI
QEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSV
RKLILFLETTLSERASRGSFHVSQAILTPRVKTIARGLVGGLKNTLVHSNRWNSHGPSLL
SQERS
GenBank ID Protein 297515471
UniProtKB/Swiss-Prot ID Q0VAA5
UniProtKB/Swiss-Prot Entry Name PLCX2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001185106.1
GeneCard ID PLCXD2
GenAtlas ID PLCXD2
HGNC ID HGNC:26462
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]