You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP04824
Secondary Accession Numbers
  • 10418
Name Selenocysteine lyase
Synonyms
  1. hSCL
Gene Name SCLY
Protein Type Enzyme
Biological Properties
General Function Involved in metabolic process
Specific Function Catalyzes the decomposition of L-selenocysteine to L-alanine and elemental selenium (By similarity).
Pathways
  • Selenoamino Acid Metabolism
  • Selenocompound metabolism
Reactions
Selenocysteine + reduced acceptor → Hydrogen selenide + L-Alanine + acceptor details
Selenocysteine + Reduced acceptor → Hydrogen selenide + L-Alanine + Acceptor details
Se-Methylselenocysteine + Water → Pyruvic acid + Ammonia + Methaneselenol details
GO Classification
Biological Process
cellular amino acid metabolic process
Cellular Component
cytosol
Function
binding
catalytic activity
cofactor binding
pyridoxal phosphate binding
Molecular Function
transferase activity
pyridoxal phosphate binding
selenocysteine lyase activity
Process
metabolic process
Cellular Location
  1. Cytoplasm
  2. cytosol
Gene Properties
Chromosome Location 2
Locus 2q37.3
SNPs SCLY
Gene Sequence
>1338 bp
ATGGAGGCGGCCGTGGCGCCGGGGAGGGATGCGCCGGCACCCGCGGCGAGTCAGCCCAGC
GGCTGCGGGAAACACAACTCGCCGGAGAGGAAAGTTTATATGGACTATAATGCAACGACT
CCCCTGGAGCCAGAAGTTATCCAGGCCATGACCAAGGCCATGTGGGAAGCCTGGGGAAAT
CCCAGCAGCCCGTATTCAGCAGGAAGAAAGGCCAAGGATATTATAAATGCAGCTCGGGAA
AGCCTCGCGAAGATGATAGGGGGGAAACCTCAAGATATAATCTTCACTTCCGGGGGCACT
GAGTCAAATAATTTAGTAATCCATTCTGTGGTGAAACATTTCCACGCAAACCAGACCTCA
AAGGGACACACAGGTGGGCACCACAGCCCAGTGAAGGGGGCCAAGCCCCATTTCATTACT
TCCTCGGTGGAACACGACTCCATCCGGCTGCCCCTGGAGCACCTGGTGGAAGAACAAGTG
GCAGCGGTCACCTTTGTCCCGGTGTCCAAGGTGAGCGGGCAGGCAGAGGTGGACGACATC
CTCGCGGCAGTCCGCCCGACCACACGCCTCGTGACCATCATGCTGGCCAACAATGAGACT
GGCATTGTCATGCCTGTCCCTGAAATCAGTCAGCGCATTAAAGCCCTGAACCAGGAACGG
GTGGCAGCTGGGCTACCTCCCATCCTCGTGCACACGGATGCTGCACAGGCCTTGGGGAAG
CAGCGCGTGGATGTGGAGGACCTGGGCGTGGACTTCCTTACAATCGTGGGGCACAAGTTT
TATGGTCCCAGGATTGGCGCACTTTATATACGAGGACTTGGTGAATTTACCCCTCTCTAC
CCTATGCTATTTGGAGGTGGACAAGAACGGAATTTCAGGCCAGGGACAGAGAACACCCCA
ATGATTGCTGGCCTTGGGAAGGCCGCGGAGCTGGTGACCCAGAACTGCGAGGCTTATGAG
GCCCACATGAGGGACGTCCGCGACTACCTGGAAGAGAGGCTGGAAGCTGAATTCGGTCAG
AAGAGAATCCATCTGAATAGCCAGTTTCCAGGCACCCAGCGGCTTCCCAATACCTGTAAC
TTTTCCATCCGGGGACCCCGGCTTCAAGGCCACGTGGTGCTTGCGCAGTGCCGAGTGCTG
ATGGCCAGTGTGGGGGCCGCGTGCCACTCGGACCACGGGGACCAGCCGTCCCCAGTGCTG
CTGAGCTACGGTGTCCCCTTCGACGTGGCCAGGAACGCGCTCCGGCTCAGCGTGGGCCGC
AGCACCACCAGGGCCGAGGTGGACCTCGTCGTGCAGGACCTGAAGCAGGCCGTGGCGCAG
CTGGAGGACCAGGCCTAG
Protein Properties
Number of Residues 445
Molecular Weight 48793.15
Theoretical pI 7.124
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Selenocysteine lyase
MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGN
PSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTS
KGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQAEVDDI
LAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVHTDAAQALGK
QRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTP
MIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCN
FSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGR
STTRAEVDLVVQDLKQAVAQLEDQA
GenBank ID Protein 156713448
UniProtKB/Swiss-Prot ID Q96I15
UniProtKB/Swiss-Prot Entry Name SCLY_HUMAN
PDB IDs
GenBank Gene ID NM_016510.4
GeneCard ID SCLY
GenAtlas ID SCLY
HGNC ID HGNC:18161
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Mihara H, Kurihara T, Watanabe T, Yoshimura T, Esaki N: cDNA cloning, purification, and characterization of mouse liver selenocysteine lyase. Candidate for selenium delivery protein in selenoprotein synthesis. J Biol Chem. 2000 Mar 3;275(9):6195-200. [PubMed:10692412 ]
  6. Jafari C, Panzer U, Steinmetz OM, Zahner G, Stahl RA, Harendza S: Enhanced expression of selenocysteine lyase in acute glomerulonephritis and its regulation by AP-1. Cell Mol Biol Lett. 2006;11(3):424-37. [PubMed:16874457 ]