Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05100
Secondary Accession Numbers
  • 10697
Name Glucose-6-phosphatase 2
Synonyms
  1. G-6-Pase 2
  2. G6Pase 2
  3. Islet-specific glucose-6-phosphatase catalytic subunit-related protein
Gene Name G6PC2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function May hydrolyze glucose-6-phosphate to glucose in the endoplasmic reticulum. May be responsible for glucose production through glycogenolysis and gluconeogenesis (By similarity).
Pathways
  • Adipocytokine signaling pathway
  • Carbohydrate digestion and absorption
  • Galactose metabolism
  • gluconeogenesis
  • Glycolysis / Gluconeogenesis
  • Insulin signaling pathway
  • PI3K-Akt signaling pathway
  • Starch and sucrose metabolism
Reactions
Glucose 6-phosphate + Water → D-Glucose + Phosphate details
Glucose 6-phosphate + Water → alpha-D-Glucose + Phosphate details
GO Classification
Biological Process
small molecule metabolic process
glucose transport
gluconeogenesis
glucose homeostasis
regulation of insulin secretion
carbohydrate metabolic process
transmembrane transport
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Component
membrane
cell part
Function
catalytic activity
Molecular Function
glucose-6-phosphatase activity
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 2
Locus 2q24.3
SNPs G6PC2
Gene Sequence
>1068 bp
ATGGATTTCCTTCACAGGAATGGAGTGCTCATAATTCAGCATTTGCAGAAGGACTACCGA
GCTTACTACACTTTTCTAAATTTTATGTCCAATGTTGGAGACCCCAGGAATATCTTTTTC
ATTTATTTTCCACTTTGTTTTCAATTTAATCAGACAGTTGGAACCAAGATGATATGGGTA
GCAGTCATTGGGGATTGGTTAAATCTTATATTTAAATGGATATTATTTGGTCATCGACCT
TACTGGTGGGTCCAAGAAACTCAGATTTACCCAAATCACTCAAGTCCATGCCTTGAACAG
TTCCCTACTACATGTGAAACAGGTCCAGGAAGTCCATCTGGCCATGCAATGGGCGCATCC
TGTGTCTGGTATGTCATGGTAACCGCTGCCCTGAGCCACACTGTCTGTGGGATGGATAAG
TTCTCTATCACTCTGCACAGACTGACCTGGTCATTTCTTTGGAGTGTTTTTTGGTTGATT
CAAATCAGTGTCTGCATCTCCAGAGTATTCATAGCAACACATTTTCCTCATCAAGTTATT
CTTGGAGTAATTGGTGGCATGCTGGTGGCAGAGGCCTTTGAACACACTCCAGGCATCCAA
ACGGCCAGTCTGGGCACATACCTGAAGACCAACCTCTTTCTCTTCCTGTTTGCAGTTGGC
TTTTACCTGCTTCTTAGGGTGCTCAACATTGACCTGCTGTGGTCCGTGCCCATAGCCAAA
AAGTGGTGTGCTAACCCCGACTGGATCCACATTGACACCACGCCTTTTGCTGGACTCGTG
AGAAACCTTGGGGTCCTCTTTGGCTTGGGCTTTGCAATCAACTCAGAGATGTTCCTCCTG
AGCTGCCGAGGGGGAAATAACTACACACTGAGCTTCCGGTTGCTCTGTGCCTTGACCTCA
TTGACAATACTGCAGCTCTACCATTTCCTCCAGATCCCGACTCACGAAGAGCATTTATTT
TATGTGCTGTCTTTTTGTAAAAGTGCATCCATTCCCCTAACTGTGGTTGCTTTCATTCCC
TACTCTGTTCATATGTTAATGAAACAAAGCGGAAAGAAGAGTCAGTAG
Protein Properties
Number of Residues 355
Molecular Weight 17756.465
Theoretical pI 8.121
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glucose-6-phosphatase 2
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS
LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQSGKKSQ
GenBank ID Protein 9082328
UniProtKB/Swiss-Prot ID Q9NQR9
UniProtKB/Swiss-Prot Entry Name G6PC2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF283835
GeneCard ID G6PC2
GenAtlas ID G6PC2
HGNC ID HGNC:28906
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Martin CC, Bischof LJ, Bergman B, Hornbuckle LA, Hilliker C, Frigeri C, Wahl D, Svitek CA, Wong R, Goldman JK, Oeser JK, Lepretre F, Froguel P, O'Brien RM, Hutton JC: Cloning and characterization of the human and rat islet-specific glucose-6-phosphatase catalytic subunit-related protein (IGRP) genes. J Biol Chem. 2001 Jul 6;276(27):25197-207. Epub 2001 Apr 10. [PubMed:11297555 ]
  4. Shieh JJ, Pan CJ, Mansfield BC, Chou JY: The islet-specific glucose-6-phosphatase-related protein, implicated in diabetes, is a glycoprotein embedded in the endoplasmic reticulum membrane. FEBS Lett. 2004 Mar 26;562(1-3):160-4. [PubMed:15044018 ]
  5. Petrolonis AJ, Yang Q, Tummino PJ, Fish SM, Prack AE, Jain S, Parsons TF, Li P, Dales NA, Ge L, Langston SP, Schuller AG, An WF, Tartaglia LA, Chen H, Hong SB: Enzymatic characterization of the pancreatic islet-specific glucose-6-phosphatase-related protein (IGRP). J Biol Chem. 2004 Apr 2;279(14):13976-83. Epub 2004 Jan 13. [PubMed:14722102 ]
  6. Dogra RS, Vaidyanathan P, Prabakar KR, Marshall KE, Hutton JC, Pugliese A: Alternative splicing of G6PC2, the gene coding for the islet-specific glucose-6-phosphatase catalytic subunit-related protein (IGRP), results in differential expression in human thymus and spleen compared with pancreas. Diabetologia. 2006 May;49(5):953-7. Epub 2006 Mar 7. [PubMed:16520917 ]
  7. Bouatia-Naji N, Rocheleau G, Van Lommel L, Lemaire K, Schuit F, Cavalcanti-Proenca C, Marchand M, Hartikainen AL, Sovio U, De Graeve F, Rung J, Vaxillaire M, Tichet J, Marre M, Balkau B, Weill J, Elliott P, Jarvelin MR, Meyre D, Polychronakos C, Dina C, Sladek R, Froguel P: A polymorphism within the G6PC2 gene is associated with fasting plasma glucose levels. Science. 2008 May 23;320(5879):1085-8. doi: 10.1126/science.1156849. Epub 2008 May 1. [PubMed:18451265 ]