Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05245
Secondary Accession Numbers
  • 10843
Name Anion exchange transporter
Synonyms
  1. Solute carrier family 26 member 7
Gene Name SLC26A7
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Acts as a sodium-independent DIDS-sensitive anion exchanger mediating bicarbonate, chloride, sulfate and oxalate transport. May play a role in the maintenance of the electrolyte and acid-base homeostasis in the kidney, by acting as a distal excretory segment-specific anion exchanger. Plays a major role in gastric acid secretion
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Multi-pass membrane protein
  2. Recycling endosome membrane
Gene Properties
Chromosome Location Chromosome:8
Locus 8q23
SNPs SLC26A7
Gene Sequence
>1971 bp
ATGACAGGAGCAAAGAGGAAAAAGAAAAGCATGCTTTGGAGCAAGATGCATACCCCCCAG
TGTGAAGACATTATACAGTGGTGTAGAAGGCGACTGCCCATTTTGGATTGGGCACCACAT
TACAATCTGAAAGAAAACTTGCTTCCAGACACTGTGTCTGGGATAATGTTGGCAGTTCAA
CAGGTGACCCAAGGATTGGCCTTTGCTGTTCTCTCATCTGTGCACCCAGTGTTTGGTTTA
TATGGGTCTCTGTTTCCTGCCATAATTTATGCCATATTTGGAATGGGACATCATGTTGCC
ACAGGCACCTTTGCCTTGACATCCTTAATATCAGCCAACGCCGTGGAACGGATTGTCCCT
CAGAACATGCAGAATCTCACCACACAGAGTAACACAAGCGTGCTGGGCTTATCCGACTTT
GAAATGCAAAGGATCCACGTTGCTGCAGCAGTTTCCTTCTTGGGAGGTGTGATTCAGGTG
GCCATGTTTGTGCTGCAACTGGGCAGTGCCACATTTGTGGTCACAGAGCCTGTGATCAGC
GCAATGACAACTGGGGCTGCCACCCATGTGGTGACTTCACAAGTCAAATATCTCTTGGGA
ATGAAAATGCCATATATATCCGGACCACTTGGATTCTTTTATATTTATGCATATGTTTTT
GAAAACATCAAGTCTGTGCGACTGGAGGCATTGCTTTTATCCTTGCTGAGCATTGTGGTC
CTTGTTCTTGTTAAAGAGCTGAATGAACAGTTTAAAAGGAAAATTAAAGTTGTTCTTCCT
GTAGATTTAGTTTTGATTATTGCTGCATCATTTGCTTGTTATTGCACCAATATGGAAAAC
ACATATGGATTAGAAGTAGTTGGTCATATTCCACAAGGAATTCCCTCACCTAGAGCTCCC
CCGATGAACATCCTCTCTGCGGTGATCACTGAAGCTTTCGGAGTGGCACTTGTAGGCTAT
GTGGCCTCACTGGCTCTTGCTCAAGGATCTGCCAAAAAATTCAAATATTCAATTGATGAC
AACCAGGAATTTTTGGCCCATGGCCTCAGCAATATAGTTTCTTCATTTTTCTTCTGCATA
CCAAGTGCTGCTGCCATGGGAAGGACGGCTGGCCTGTACAGCACAGGAGCGAAGACACAG
GTGGCTTGTCTAATATCTTGCATTTTCGTCCTTATAGTCATCTATGCAATAGGACCTTTG
CTTTACTGGCTGCCCATGTGTGTCCTTGCAAGCATTATTGTTGTGGGACTGAAGGGAATG
CTAATACAGTTCCGAGATTTAAAAAAATATTGGAATGTGGATAAAATCGATTGGGGAATA
TGGGTCAGTACATATGTATTTACAATATGCTTTGCTGCCAATGTGGGACTGCTGTTTGGT
GTTGTTTGTACCATAGCTATAGTGATAGGACGCTTCCCAAGAGCAATGACTGTAAGTATA
AAAAATATGAAAGAAATGGAATTTAAAGTGAAGACAGAAATGGACAGTGAAACCCTGCAG
CAGGTGAAAATTATCTCAATAAACAACCCGCTTGTTTTCCTGAATGCAAAAAAATTTTAT
ACTGATTTAATGAACATGATCCAAAAGGAAAATGCCTGTAATCAGCCACTTGATGATATC
AGCAAGTGTGAACAAAACACATTGCTTAATTCCCTATCCAATGGCAACTGCAATGAAGAA
GCTTCACAGTCCTGCCCTAATGAGAAGTGTTATTTAATCCTGGATTGCAGTGGATTTACC
TTTTTTGACTATTCTGGAGTCTCCATGCTTGTTGAGGTTTACATGGACTGTAAAGGCAGG
AGTGTGGATGTATTGTTAGCCCATTGTACAGCTTCCTTGATAAAAGCAATGACGTATTAT
GGAAACCTAGACTCAGAGAAACCAATTTTTTTTGAATCGGTATCTGCTGCAATAAGTCAT
ATCCATTCAAATAAGAATTTGAGCAAACTCAGTGACCACAGTGAAGTCTGA
Protein Properties
Number of Residues 656
Molecular Weight 72212.2
Theoretical pI 7.96
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 76-96
  • 145-165
  • 167-187
  • 203-223
  • 228-248
  • 255-275
  • 307-327
  • 344-364
  • 384-404
  • 405-425
  • 449-469
Protein Sequence
>Anion exchange transporter
MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV
GenBank ID Protein 15341552
UniProtKB/Swiss-Prot ID Q8TE54
UniProtKB/Swiss-Prot Entry Name S26A7_HUMAN
PDB IDs Not Available
GenBank Gene ID AF331521
GeneCard ID SLC26A7
GenAtlas ID SLC26A7
HGNC ID HGNC:14467
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Lohi H, Kujala M, Makela S, Lehtonen E, Kestila M, Saarialho-Kere U, Markovich D, Kere J: Functional characterization of three novel tissue-specific anion exchangers SLC26A7, -A8, and -A9. J Biol Chem. 2002 Apr 19;277(16):14246-54. Epub 2002 Feb 7. [PubMed:11834742 ]
  3. Vincourt JB, Jullien D, Kossida S, Amalric F, Girard JP: Molecular cloning of SLC26A7, a novel member of the SLC26 sulfate/anion transporter family, from high endothelial venules and kidney. Genomics. 2002 Feb;79(2):249-56. [PubMed:11829495 ]
  4. Petrovic S, Ju X, Barone S, Seidler U, Alper SL, Lohi H, Kere J, Soleimani M: Identification of a basolateral Cl-/HCO3- exchanger specific to gastric parietal cells. Am J Physiol Gastrointest Liver Physiol. 2003 Jun;284(6):G1093-103. [PubMed:12736153 ]
  5. Kujala M, Tienari J, Lohi H, Elomaa O, Sariola H, Lehtonen E, Kere J: SLC26A6 and SLC26A7 anion exchangers have a distinct distribution in human kidney. Nephron Exp Nephrol. 2005;101(2):e50-8. Epub 2005 Jun 14. [PubMed:15956810 ]
  6. Xu J, Worrell RT, Li HC, Barone SL, Petrovic S, Amlal H, Soleimani M: Chloride/bicarbonate exchanger SLC26A7 is localized in endosomes in medullary collecting duct cells and is targeted to the basolateral membrane in hypertonicity and potassium depletion. J Am Soc Nephrol. 2006 Apr;17(4):956-67. Epub 2006 Mar 8. [PubMed:16524946 ]
  7. Kujala M, Hihnala S, Tienari J, Kaunisto K, Hastbacka J, Holmberg C, Kere J, Hoglund P: Expression of ion transport-associated proteins in human efferent and epididymal ducts. Reproduction. 2007 Apr;133(4):775-84. [PubMed:17504921 ]