Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05284
Secondary Accession Numbers
  • 10883
Name Polypeptide N-acetylgalactosaminyltransferase 9
Synonyms
  1. GalNAc-T9
  2. Polypeptide GalNAc transferase 9
  3. Protein-UDP acetylgalactosaminyltransferase 9
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 9
  5. pp-GaNTase 9
Gene Name GALNT9
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Does not glycosylate apomucin or SDC3.
Pathways
  • Mucin type O-glycan biosynthesis
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + polypeptide → Uridine 5'-diphosphate + N-acetyl-alpha-D-galactosaminyl-polypeptide details
UDP-N-acetyl-D-galactosamine + Protein serine → UDP + Tn antigen details
GO Classification
Biological Process
O-glycan processing
post-translational protein modification
Cellular Component
integral to membrane
Golgi membrane
Function
binding
protein binding
Molecular Function
polypeptide N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 12
Locus 12q24.33
SNPs GALNT9
Gene Sequence
>1812 bp
ATGGCGGTGGCCAGGAAGATCCGAACTTTGCTGACGGTGAACATCCTGGTGTTCGTGGGC
ATCGTCCTGTTCTCCGTGTACTGCCGCCTGCAGGGCCGCTCCCAGGAGCTCGTGCGCATC
GTGAGCGGCGACCGCCGGGTGCGCAGCCGACACGCCAAGGTGGGCACGCTGGGGGACCGT
GAGGCCATCCTGCAGCGCCTGGACCACCTGGAGGAGGTGGTCTACAACCAGCTCAACGGC
CTTGCCAAGCCCATCGGCCTGGTGGAGGGGCCAGGAGGTCTGGGCCAGGGTGGCTTGGCG
GCCACCCTGCGTGATGACGGCCAGGAGGCGGAAGGCAAGTATGAGGAGTACGGCTACAAC
GCTCAGCTCAGCGACCGCATCTCCCTCGATCGGAGCATCCCCGACTACCGGCCCAGAAAG
TGCAGACAGATGAGCTACGCCCAGGACCTGCCCCAGGTCTCCGTGGTCTTCATCTTCGTC
AATGAGGCGCTGTCGGTCATCCTGCGCTCCGTGCACAGCGTGGTCAACCACACGCCCTCC
CAGCTCCTCAAGGAGGTCATCCTGGTGGACGACAACAGTGACAACGTGGAACTCAAGTTC
AATCTGGACCAGTACGTCAACAAGCGGTACCCAGGCCTCGTGAAGATTGTCCGCAACAGC
CGGCGGGAAGGACTGATCCGCGCGCGGCTGCAGGGCTGGAAGGCGGCCACCGCCCCAGTC
GTCGGCTTCTTTGATGCCCACGTCGAGTTCAACACGGGTTGGGCCGAGCCCGCACTGTCG
CGGATCCGAGAGGACCGGCGTCGCATCGTGCTGCCAGCCATCGACAACATCAAGTACAGC
ACGTTTGAGGTGCAGCAGTATGCGAACGCCGCCCATGGCTACAACTGGGGCCTCCGGTGC
ATGTACATCATCCCCCCGCAGGACTGGCTGGACCGCGGCGACGAGTCAGCACCCATCAGG
ACCCCAGCCATGATCGGCTGCTCCTTCGTAGTGGACCGCGAGTACTTCGGAGACATTGGG
CTGCTGGACCCCGGCATGGAGGTGTATGGCGGCGAGAACGTAGAACTGGGCATGAGGGTG
TGGCAGTGTGGCGGCAGCATGGAGGTGCTGCCCTGCTCCCGCGTGGCCCACATCGAGCGC
ACCAGGAAGCCCTACAACAACGACATTGACTACTACGCCAAGCGCAACGCCCTGCGCGCC
GCCGAGGTGTGGATGGATGACTTCAAGTCCCACGTGTACATGGCCTGGAACATCCCCATG
TCGAACCCAGGGGTGGACTTCGGGGACGTGTCTGAGAGGCTGGCCCTGCGTCAGAGGCTG
AAGTGTCGCAGCTTCAAGTGGTACCTGGAGAACGTGTACCCGGAGATGAGGGTCTACAAC
AACACCCTCACGTACGGAGAGGTGAGAAACAGCAAAGCCAGTGCCTACTGTCTGGACCAG
GGAGCGGAGGACGGCGACCGGGCGATCCTCTACCCCTGCCACGGGATGTCCTCCCAGCTG
GTGCGGTACAGCGCTGACGGCCTGCTGCAGCTGGGGCCTCTGGGCTCCACAGCCTTCTTG
CCTGACTCCAAGTGTCTGGTGGATGACGGCACGGGCCGCATGCCCACCCTGAAGAGGTGT
GAGGATGTGGCGCGGCCAACACAGCGGCTGTGGGACTTCACCCAGAGTGGCCCCATTGTG
AGCCGGGCCACGGGCCGCTGCCTGGAGGTGGAGATGTCCAAAGATGCCAACTTTGGGCTC
CGGCTGGTGGTACAGAGGTGCTCGGGGCAGAAGTGGATGATCAGAAACTGGATCAAACAC
GCACGGCACTGA
Protein Properties
Number of Residues 603
Molecular Weight 68388.61
Theoretical pI 8.35
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Polypeptide N-acetylgalactosaminyltransferase 9
MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRIVSGDRRVRSRHAKVGTLGDR
EAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGLAATLRDDGQEAEGKYEEYGYN
AQLSDRISLDRSIPDYRPRKCRQMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNHTPS
QLLKEVILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKAATAPV
VGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQQYANAAHGYNWGLRC
MYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMRV
WQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPM
SNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASAYCLDQ
GAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGTGRMPTLKKC
EDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKH
ARH
GenBank ID Protein 10336504
UniProtKB/Swiss-Prot ID Q9HCQ5
UniProtKB/Swiss-Prot Entry Name GALT9_HUMAN
PDB IDs Not Available
GenBank Gene ID AB040672
GeneCard ID GALNT9
GenAtlas ID GALNT9
HGNC ID HGNC:4131
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zhang Y, Iwasaki H, Wang H, Kudo T, Kalka TB, Hennet T, Kubota T, Cheng L, Inaba N, Gotoh M, Togayachi A, Guo J, Hisatomi H, Nakajima K, Nishihara S, Nakamura M, Marth JD, Narimatsu H: Cloning and characterization of a new human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase, designated pp-GalNAc-T13, that is specifically expressed in neurons and synthesizes GalNAc alpha-serine/threonine antigen. J Biol Chem. 2003 Jan 3;278(1):573-84. Epub 2002 Oct 28. [PubMed:12407114 ]
  3. Toba S, Tenno M, Konishi M, Mikami T, Itoh N, Kurosaka A: Brain-specific expression of a novel human UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T9). Biochim Biophys Acta. 2000 Sep 7;1493(1-2):264-8. [PubMed:10978536 ]