Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05360
Secondary Accession Numbers
  • 10959
Name Probable proline dehydrogenase 2
Synonyms
  1. HsPOX1
  2. Kidney and liver proline oxidase 1
  3. Probable proline oxidase 2
Gene Name PRODH2
Protein Type Unknown
Biological Properties
General Function Involved in proline dehydrogenase activity
Specific Function Converts proline to delta-1-pyrroline-5-carboxylate (Probable).
Pathways
  • Arginine and proline metabolism
  • L-proline degradation into L-glutamate
Reactions
L-Proline + acceptor → 1-Pyrroline-5-carboxylic acid + reduced acceptor details
GO Classification
Biological Process
glutamate biosynthetic process
proline catabolic process to glutamate
Cellular Component
mitochondrial inner membrane
Function
proline dehydrogenase activity
catalytic activity
oxidoreductase activity, acting on the ch-nh group of donors
oxidoreductase activity
Molecular Function
proline dehydrogenase activity
Process
proline catabolic process
glutamate metabolic process
glutamate biosynthetic process
metabolic process
cellular metabolic process
glutamine family amino acid metabolic process
proline metabolic process
oxidation reduction
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19q13.1
SNPs PRODH2
Gene Sequence
>1611 bp
ATGTCGCCCAGGGTAGTCTCAAACTCCTCGGTCTTGGCCTCCCAAAGTGTTGGGATTACA
AACGTGAGAACCGTATTTTCAAATGTATTCAATAACACTACAGCGTTTCCAATTTTAAGA
GGAAGCAATTGCCACAAAATCACTGCCCCTGGTCTGGGCAAGGGGCAGTTGGTGAACTTG
CTGCCTCCAGAGAACCTTCCCTGGTGTGGAGGCAGCCAGGGACCCAGGATGCTCCGGACC
TGTTACGTGCTCTGTTCCCAAGCTGGTCCCCCCTCCAGGGGCTGGCAGTCCCTGAGCTTT
GATGGCGGGGCCTTCCACCTTAAGGGCACAGGAGAGCTGACACGGGCCTTGCTGGTTCTC
CGGCTGTGTGCCTGGCCCCCACTCGTCACTCACGGGCTGTTGCTCCAGGCCTGGTCTCGG
CGACTCCTGGGCTCCCGGCTCTCAGGCGCATTTCTCCGAGCATCCGTCTATGGGCAGTTT
GTGGCTGGTGAGACAGCAGAGGAGGTGAAGGGCTGCGTGCAGCAGCTGCGGACCCTCAGC
CTCCGACCACTGCTGGCAGTGCCCACTGAGGAGGAGCCGGACTCTGCTGCCAAGAGTGGT
GAGGCGTGGTATGAGGGGAACCTCGGTGCTATGCTGCGGTGTGTGGACCTGTCACGGGGC
CTCCTGGAGCCCCCCAGCCTGGCTGAGGCCAGCCTCATGCAGCTGAAGGTGACGGCGCTG
ACCAGTACTCGGCTCTGTAAGGAGCTAGCCTCGTGGGTCAGAAGGCCAGGAGCCTCCTTG
GAGCTGAGCCCCGAGAGGCTGGCTGAAGCTATGGACTCTGGGCAGAACCTCCAGGTCTCC
TGCCTCAATGCTGAGCAGAACCAGCACCTCCGGGCCTCCCTCAGCCGCCTGCATCGGGTG
GCACAGTATGCCCGGGCCCAGCACGTGCGGCTCCTGGTGGATGCGGAGTACACCTCACTG
AACCCTGCGCTCTCGCTGCTGGTGGCTGCCCTGGCTGTGCGCTGGAACAGCCCGGGTGAA
GGCGGGCCCTGGGTGTGGAACACCTACCAGGCCTGTCTAAAGGACACATTCGAGCGGCTG
GGGAGGGATGCAGAGGCTGCGCACAGGGCCGGCCTGGCCTTCGGAGTGAAGCTGGTACGA
GGTGCATATCTGGACAAGGAGAGAGCGGTGGCCCAGCTCCATGGGATGGAAGACCCCACT
CAGCCTGACTATGAGGCCACCAGTCAGAGTTACAGCCGCTGCCTGGAACTGATGCTGACG
CACGTGGCCCGCCATGGCCCCATGTGCCACCTCATGGTGGCTTCCCACAATGAGGAATCT
GTTCGCCAGGCAACCAAGCGCATGTGGGAGCTGGGCATTCCTCTGGATGGGACTGTCTGT
TTCGGACAACTTCTGGGCATGTGTGACCACGTCTCTCTAGCACTGGGGCAGGCCGGCTAT
GTAGTGTATAAGTCCATTCCCTATGGCTCCTTGGAGGAGGTAATCCCCTACCTGATCCGG
AGGGCCCAGGAGAACCGGAGCGTGCTTCAGGGTGCCCGCAGGGAACAGGAGCTGCTCAGC
CAAGAACTGTGGCGGCGGCTGCTGCCAGGATGCCGAAGGATACCCCACTAG
Protein Properties
Number of Residues 536
Molecular Weight 58870.115
Theoretical pI 8.598
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Probable proline dehydrogenase 2
MSPRVVSNSSVLASQSVGITNVRTVFSNVFNNTTAFPILRGSNCHKITAPGLGKGQLVNL
LPPENLPWCGGSQGPRMLRTCYVLCSQAGPPSRGWQSLSFDGGAFHLKGTGELTRALLVL
RLCAWPPLVTHGLLLQAWSRRLLGSRLSGAFLRASVYGQFVAGETAEEVKGCVQQLRTLS
LRPLLAVPTEEEPDSAAKSGEAWYEGNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTAL
TSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQNQHLRASLSRLHRV
AQYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQACLKDTFERL
GRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQSYSRCLELMLT
HVARHGPMCHLMVASHNEESVRQATKRMWELGIPLDGTVCFGQLLGMCDHVSLALGQAGY
VVYKSIPYGSLEEVIPYLIRRAQENRSVLQGARREQELLSQELWRRLLPGCRRIPH
GenBank ID Protein 6649583
UniProtKB/Swiss-Prot ID Q9UF12
UniProtKB/Swiss-Prot Entry Name PROD2_HUMAN
PDB IDs Not Available
GenBank Gene ID U80018
GeneCard ID PRODH2
GenAtlas ID PRODH2
HGNC ID HGNC:17325
References
General References Not Available