You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP05439
Secondary Accession Numbers
  • 11038
Name Retinol dehydrogenase 8
Synonyms
  1. Photoreceptor outer segment all-trans retinol dehydrogenase
Gene Name RDH8
Protein Type Enzyme
Biological Properties
General Function Involved in estradiol 17-beta-dehydrogenase activity
Specific Function Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinal to all-trans-retinol. May play a role in the regeneration of visual pigment at high light intensity (By similarity).
Pathways
  • Retinol metabolism
  • Retinol Metabolism
  • Vitamin A Deficiency
Reactions
Vitamin A + NADP → Retinal + NADPH details
GO Classification
Biological Process
retinol metabolic process
steroid biosynthetic process
visual perception
response to stimulus
estrogen biosynthetic process
Cellular Component
cytoplasm
integral to plasma membrane
Component
cell part
intracellular part
cytoplasm
Function
binding
catalytic activity
oxidoreductase activity
steroid dehydrogenase activity
steroid dehydrogenase activity, acting on the ch-oh group of donors, nad or nadp as acceptor
estradiol 17-beta-dehydrogenase activity
Molecular Function
retinol dehydrogenase activity
estradiol 17-beta-dehydrogenase activity
NADP-retinol dehydrogenase activity
nucleotide binding
Process
metabolic process
primary metabolic process
oxidation reduction
lipid metabolic process
steroid metabolic process
steroid biosynthetic process
estrogen biosynthetic process
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location 19
Locus 19p13.2
SNPs RDH8
Gene Sequence
>936 bp
ATGGCCGCTGCACCCCGGACTGTGTTGATCTCCGGCTGCTCATCAGGAATTGGTCTGGAA
CTTGCAGTGCAACTGGCCCATGACCCCAAGAAGCGCTACCAGGTCGTGGCCACCATGAGG
GACCTGGGGAAGAAGGAGACACTGGAGGCAGCTGCTGGGGAGGCTCTGGGGCAGACCCTC
ACCGTGGCCCAGCTGGACGTGTGCAGTGATGAGTCGGTGGCCCAGTGTCTCAGCTGTATC
CAGGGAGAAGTGGACGTGCTGGTGAATAATGCTGGAATGGGCCTGGTGGGGCCCCTGGAG
GGGCTCAGCCTTGCTGCCATGCAGAATGTCTTTGACACCAACTTTTTCGGAGCTGTCCGT
CTCGTCAAAGCTGTGCTTCCAGGCATGAAGAGGAGGCGGCAGGGCCACATCGTGGTGATC
AGCAGTGTCATGGGCCTGCAGGGTGTCATCTTCAACGATGTCTATGCAGCTTCCAAGTTC
GCCCTGGAGGGATTCTTCGAAAGCCTCGCTATCCAGCTGCTGCAGTTCAACATCTTCATC
TCCCTGGTGGAGCCAGGCCCCGTGGTCACCGAGTTTGAGGGGAAGCTTCTGGCGCAGGTT
TCTATGGCTGAGTTCCCAGGCACTGACCCTGAGACCCTGCACTACTTCCGGGACCTCTAT
CTCCCAGCCTCCAGGAAGCTGTTTTGCTCCGTGGGACAGAACCCACAGGACGTGGTTCAG
GCCATTGTCAACGTCATCAGCTCGACTCGACCACCCCTGCGCCGACAGACCAACATCCGC
TACTCGCCGCTGACCACGCTCAAAACCGTGGATTCCTCTGGCAGCCTGTATGTGCGAACG
ACCCACCGCCTCCTCTTCCGCTGTCCACGCCTCCTCAACCTTGGCCTTCAATGTCTGTCC
TGCGGCTGCCTCCCAACGCGGGTGCGGCCAAGATGA
Protein Properties
Number of Residues 311
Molecular Weight 35804.24
Theoretical pI 8.238
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Retinol dehydrogenase 8
MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQTL
TVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVR
LVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFI
SLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQ
AIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCLS
CGCLPTRVRPR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NYR8
UniProtKB/Swiss-Prot Entry Name RDH8_HUMAN
PDB IDs Not Available
GenBank Gene ID AF229845
GeneCard ID RDH8
GenAtlas ID RDH8
HGNC ID HGNC:14423
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Rattner A, Smallwood PM, Nathans J: Identification and characterization of all-trans-retinol dehydrogenase from photoreceptor outer segments, the visual cycle enzyme that reduces all-trans-retinal to all-trans-retinol. J Biol Chem. 2000 Apr 14;275(15):11034-43. [PubMed:10753906 ]